1ZTX: West Nile Virus Envelope Protein DIII

West Nile Virus Envelope Protein DIII in complex with neutralizing E16 antibody Fab. Determined by X-ray diffraction at 2.5 Å resolution. Released 4 Oct 2005.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: West Nile virus, Mus musculus
Chains: 3
Atoms: 4,296
Mol. weight: 58.14 kDa
Released: 4 Oct 2005

Explore 1ZTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZTX contains 15 α-helices and 52 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	304	1	1
β-strand	309-317	9	2
β-strand	323-329	7	2
β-strand	336-337	2	1
β-strand	340-345	6	3
β-strand	348-351	4	3
β-strand	354-355	2	2
β-strand	361-362	2	1
β-strand	369-376	8	2
α-helix	377-378	2
β-strand	380-386	7	3
α-helix	389-391	3
β-strand	393-399	7	3

Chain H: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	4
α-helix	7-9	3
β-strand	10-12	3	5
β-strand	18-25	8	4
α-helix	29-31	3
β-strand	33-39	7	5
β-strand	46-52	7	5
β-strand	56-59	4	5
β-strand	66-72	7	4
β-strand	77-82A	7	4
α-helix	84-86	3
β-strand	88-95	8	5
β-strand	100B-103	4	5
β-strand	107-111	5	5
α-helix	115-116	2
β-strand	117	1	6
α-helix	118-119	2
β-strand	120-124	5	7
β-strand	137-147	11	7
β-strand	148	1	6
β-strand	153-162	5	8
β-strand	169-179	10	7
β-strand	184-194	11	7
α-helix	195-198	3
β-strand	206-212	6	8
α-helix	213-215	3
β-strand	217-222	6	8

Chain L: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	9
β-strand	10-13	4	5
β-strand	19-25	7	9
β-strand	33-38	6	5
β-strand	45-49	5	5
β-strand	53-54	2	5
α-helix	55	1
β-strand	62-67	6	9
β-strand	70-75	6	9
α-helix	80-82	3
β-strand	85-90	6	5
α-helix	96	1
β-strand	97-98	2	5
β-strand	102-106	5	5
β-strand	111	1	10
β-strand	114-118	5	11
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	11
β-strand	140	1	10
β-strand	145-150	6	12
β-strand	153-155	3	12
β-strand	159-163	5	11
β-strand	173-182	10	11
α-helix	183-188	6
β-strand	192-197	6	12
β-strand	205-209	5	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope protein	E	protein	108	West Nile virus	Q91KZ4
Heavy Chain of E16 Antibody	H	protein	219	Mus musculus	P01867 (AlphaFold model)
Light Chain of E16 Antibody	L	protein	212	Mus musculus

Sequence of entity 1 (E), FASTA

>1ZTX_1 Envelope protein (chains E)
GSQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVG
RLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSG

Sequence of entity 2 (H), FASTA

>1ZTX_2 Heavy Chain of E16 Antibody (chains H)
QVQLQQSGSELMKPGASVQISCKATGYTFSDYWIEWVKQRPGHGLEWIGDILCGTGRTRY
NEKLKAMATFTADTSSNTAFMQLSSLTSEDSAVYYCARSASYGDYADYWGHGTTLTVSSA
KTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGL
YTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS

Sequence of entity 3 (L), FASTA

>1ZTX_3 Light Chain of E16 Antibody (chains L)
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLISWASTRHTGVPD
RFTGSGSGTDYTLTISSVQAEDLALYYCQQHYTTPLTFGAGTKLELKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Primary citation

Structural basis of West Nile virus neutralization by a therapeutic antibody. Nybakken, G.E., Oliphant, T., Johnson, S. et al. Nature (2005) 437:764-769. DOI 10.1038/nature03956 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1ZTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.