Yeast Hsp82 in complex with the novel Hsp90 inhibitor Radester amine. Determined by X-ray diffraction at 1.65 Å resolution. Released 13 Jun 2006.
Explore 1ZWH in 3D Show helices and sheets RCSB PDB PDBe
1ZWH contains 14 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| α-helix | 8-9 | 2 | |
| α-helix | 10-21 | 12 | |
| α-helix | 29-48 | 20 | |
| α-helix | 53-56 | 4 | |
| β-strand | 64-69 | 6 | 1 |
| α-helix | 70-72 | 3 | |
| β-strand | 74-79 | 6 | 1 |
| α-helix | 86-90 | 5 | |
| α-helix | 91-95 | 5 | |
| α-helix | 97-98 | 2 | |
| α-helix | 99-110 | 12 | |
| α-helix | 114-120 | 7 | |
| α-helix | 123-129 | 7 | |
| β-strand | 131-139 | 9 | 1 |
| β-strand | 146-150 | 5 | 1 |
| β-strand | 155-160 | 6 | 1 |
| α-helix | 165-167 | 3 | |
| β-strand | 170-177 | 8 | 1 |
| α-helix | 182-185 | 4 | |
| α-helix | 187-197 | 11 | |
| β-strand | 205-207 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ATP-dependent molecular chaperone HSP82 | A | protein | 240 | Saccharomyces cerevisiae | P02829 (AlphaFold model) |
>1ZWH_1 ATP-dependent molecular chaperone HSP82 (chains A) MGSSHHHHHHSSGLVPRGSHMASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASD ALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSG TKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTL DEVNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVTKEVEKEVPIP
| ID | Name | Formula | Copies |
|---|---|---|---|
| RDE | 2-(3-amino-2,5,6-trimethoxyphenyl)ethyl 5-chloro-2,4-dihydroxybenzoate | C18 H20 Cl N O7 | 1 |
Inhibitory Ligands Adopt Different Conformations When Bound to Hsp90 or GRP94: Implications for Paralog-specific Drug Design. Immormino, R.M., Blagg, B.S., Gewirth, D.T. To be published.
Other PDB entries of the same protein (UniProt P02829 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ZWH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.