23XM: Human sodium/proton antiporter NHE1

Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Eniporide in an outward-open conformation. Determined by electron microscopy at 3.24 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 3.24 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,638
Mol. weight: 182.37 kDa
Ligands: A1E6D
Released: 8 Apr 2026

Explore 23XM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

23XM contains 48 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	101-118	18
α-helix	131-149	19
α-helix	152-154	3
α-helix	158-160	3
α-helix	161-165	5
α-helix	166-175	10
α-helix	180-183	4
α-helix	186-190	5
α-helix	191-196	6
α-helix	197-215	19
α-helix	224-234	11
α-helix	239-248	10
α-helix	255-280	26
α-helix	288-320	33
α-helix	330-347	18
α-helix	352-370	19
α-helix	373-403	31
α-helix	411-437	27
α-helix	443-445	3
α-helix	446-454	9
α-helix	460-468	9
α-helix	477-489	13
α-helix	490-495	6
α-helix	496-506	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/hydrogen exchanger 1	A, B	protein	815	Homo sapiens	P19634 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>23XM_1 Sodium/hydrogen exchanger 1 (chains A, B)
MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDV
TTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFV
VALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPSERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITID
PASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTP
APSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ

Ligands and cofactors

ID	Name	Formula	Copies
A1E6D	Eniporide	C14 H16 N4 O3 S	2

Primary citation

Structure and transport mechanism of the human sodium/proton antiporter NHE1. Cong, Y., Kong, F., Zhu, A. et al. To be published.

Other PDB entries of the same protein (UniProt P19634 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
2YGG 2.23 Å, Complex of CaMBR and CaM
6NUU 2.3 Å, Structure of Calcineurin mutant in complex with NHE1 peptide
2BEC 2.7 Å, Crystal structure of CHP2 in complex with its binding region in NHE1 and insights into…
23XI 2.93 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Zoniporide in…
23XK 3.1 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Cariporide in…
23XO 3.16 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Rimeporide in…
7DSW 3.3 Å, Structure of a human NHE1-CHP1 complex under pH 7.5
7DSV 3.4 Å, Structure of a human NHE1-CHP1 complex under pH 6.5
7DSX 3.5 Å, Structure of a human NHE1-CHP1 complex under pH 7.5, bound by cariporide

Browse structure collections

About this viewer

MolViewer shows 23XM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.