Human NRAS WT (GDP-bound) in complex with macrocyclic peptide inhibitor AP6296. Determined by X-ray diffraction at 1.23 Å resolution. Released 16 Sept 2026.
Explore 24SR in 3D Show helices and sheets RCSB PDB PDBe
24SR contains 18 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-10 | 9 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 38-46 | 9 | 1 |
| β-strand | 49-57 | 9 | 1 |
| α-helix | 66-74 | 9 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-104 | 18 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 152-168 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-10 | 9 | 2 |
| α-helix | 16-25 | 10 | |
| β-strand | 38-46 | 9 | 2 |
| β-strand | 49-57 | 9 | 2 |
| α-helix | 66-74 | 9 | |
| β-strand | 77-83 | 7 | 2 |
| α-helix | 87-91 | 5 | |
| α-helix | 93-104 | 12 | |
| β-strand | 111-116 | 6 | 2 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 2 |
| α-helix | 152-168 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-10 | 9 | 3 |
| α-helix | 16-25 | 10 | |
| β-strand | 38-46 | 9 | 3 |
| β-strand | 49-57 | 9 | 3 |
| α-helix | 66-74 | 9 | |
| β-strand | 77-83 | 7 | 3 |
| α-helix | 87-91 | 5 | |
| α-helix | 93-104 | 12 | |
| β-strand | 111-116 | 6 | 3 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 3 |
| α-helix | 152-166 | 15 | |
| α-helix | 167-169 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GTPase NRas | A, B, C | protein | 177 | Homo sapiens | P01111 (AlphaFold model) |
| AP6296 | I, J, K | protein | 12 | synthetic construct |
>24SR_1 GTPase NRas (chains A, B, C) GSSGGSTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDI LDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVG NKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLN
>24SR_2 AP6296 (chains I, J, K) LIGGXGXPXAXX
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
| MG | Magnesium ion | Mg | 3 |
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 3 |
Water and common crystallization additives (EDO) are not listed.
Exploiting Bridged Conformations for Precise Molecular Recognition in the Design of KRAS-Selective, Orally Available Macrocyclic Peptides. Kage, M., Kawada, H., Takano, K. et al. J Am Chem Soc (2026). DOI 10.1021/jacs.6c14212
Other PDB entries of the same protein (UniProt P01111 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 24SR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.