28WZ: Human LENG8-PCID2-SEM1 complex

Cryo-EM structure of the human LENG8-PCID2-SEM1 complex. Determined by electron microscopy at 3.5 Å resolution. Released 24 Jun 2026.

Method: Electron microscopy
Resolution: 3.5 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 3
Atoms: 4,628
Mol. weight: 136.7 kDa
Released: 24 Jun 2026

Explore 28WZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

28WZ contains 37 α-helices and 10 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	576-592	17
α-helix	596-612	17
α-helix	618-632	15
α-helix	637-653	17
α-helix	659-673	15
α-helix	676-685	10
α-helix	688-692	5
α-helix	695-708	14
α-helix	711-720	10
α-helix	725-747	23
β-strand	752-753	2	1
α-helix	754-761	8
α-helix	766-776	11
α-helix	778-779	2
β-strand	780	1	1
β-strand	787-788	2	1
α-helix	790-796	7

Chain B: 21 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	8-30	23
α-helix	58-74	17
α-helix	77-97	21
α-helix	105-129	25
α-helix	136-154	19
α-helix	155-157	3
α-helix	164-182	19
α-helix	185-187	3
α-helix	188-197	10
α-helix	206-223	18
α-helix	226-239	14
β-strand	241	1	2
α-helix	245-262	18
α-helix	264	1
β-strand	265-266	2	3
α-helix	267	1
α-helix	268-274	7
α-helix	277-288	12
α-helix	291-305	15
α-helix	311-333	23
β-strand	338-339	2	4
α-helix	340-350	11
α-helix	357-370	14
β-strand	376-378	3	4
β-strand	383-385	3	4
α-helix	395-397	3

Chain C: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	19-22	4
β-strand	32	1	2
β-strand	39-40	2	3
α-helix	51-61	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein,Leukocyte receptor cluster member 8	A	protein	687	Escherichia coli, Homo sapiens	P0AEX9 (AlphaFold model), Q96PV6 (AlphaFold model)
PCI domain-containing protein 2	B	protein	456	Homo sapiens	Q5JVF3 (AlphaFold model)
26S proteasome complex subunit SEM1	C	protein	70	Homo sapiens	P60896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>28WZ_1 Maltose/maltodextrin-binding periplasmic protein,Leukocyte receptor cluster member 8 (chains A)
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDII
FWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD
LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKD
VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG
AVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEA
LKDAQTSSGLEVLFQGPSRKKMAALECEDPERELKKQKRAARFQHGHSRRLRLEPLVLQM
SSLESSGADPDWQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEK
QDYAFACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAE
NLPGNVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHR
FFRLYCHAPCMSGYLVDKFADRERKVALKAMIKTFRPALPVSYLQAELAFEGEAACRAFL
EPLGLAYTGPDNSSIDCRLSLAQLSAF

Sequence of entity 2 (B), FASTA

>28WZ_2 PCI domain-containing protein 2 (chains B)
GKPIPNPLLGLDSTGSGKPIPNPLLGLDSTGSGKPIPNPLLGLDSTSSGLEVLFQGPMAH
ITINQYLQQVYEAIDSRDGASCAELVSFKHPHVANPRLQMASPEEKCQQVLEPPYDEMFA
AHLRCTYAVGNHDFIEAYKCQTVIVQSFLRAFQAHKEENWALPVMYAVALDLRVFANNAD
QQLVKKGKSKVGDMLEKAAELLMSCFRVCASDTRAGIEDSKKWGMLFLVNQLFKIYFKIN
KLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRS
SQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEA
FFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCI
LANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC

Sequence of entity 3 (C), FASTA

>28WZ_3 26S proteasome complex subunit SEM1 (chains C)
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS

Primary citation

Molecular basis of polyadenylated RNA fate determination in the nucleus. Bugai, A., Hohmann, U., Lorenzo, A. et al. Nature (2026) 655:1070-1078. DOI 10.1038/s41586-026-10650-0 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 28WZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.