2A07: Foxp2 bound Specifically to DNA
Crystal Structure of Foxp2 bound Specifically to DNA. Determined by X-ray diffraction at 1.9 Å resolution. Released 31 Jan 2006.
- Method
- X-ray diffraction
- Resolution
- 1.9 Å
- Organism
- Homo sapiens
- Chains
- 10
- Atoms
- 6,446
- Mol. weight
- 92.06 kDa
- Ligands
- MG
- Released
- 31 Jan 2006
Explore 2A07 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2A07 contains 27 α-helices and 19 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain F: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 509-519 | 11 | |
| β-strand | 525 | 1 | 1 |
| α-helix | 527-541 | 15 | |
| α-helix | 545-558 | 14 | |
| β-strand | 562 | 1 | 2 |
| β-strand | 565-566 | 2 | 3 |
| β-strand | 571-572 | 2 | 3 |
| β-strand | 575 | 1 | 2 |
| α-helix | 577-583 | 7 | |
Chain G: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 509-519 | 11 | |
| α-helix | 521-523 | 3 | |
| α-helix | 527-543 | 17 | |
| α-helix | 548-558 | 11 | |
| β-strand | 562-566 | 5 | 1 |
| β-strand | 571-575 | 5 | 1 |
| α-helix | 577-583 | 7 | |
Chain H: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 509-518 | 10 | |
| β-strand | 525 | 1 | 4 |
| α-helix | 527-543 | 17 | |
| α-helix | 548-558 | 11 | |
| β-strand | 562-566 | 5 | 5 |
| β-strand | 571-575 | 5 | 5 |
| α-helix | 577-583 | 7 | |
Chain I: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 509-518 | 10 | |
| β-strand | 525 | 1 | 5 |
| α-helix | 527-541 | 15 | |
| α-helix | 545-558 | 14 | |
| β-strand | 562-565 | 4 | 4 |
| β-strand | 572-575 | 4 | 4 |
| α-helix | 577-581 | 5 | |
Chains J and K: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 509-519 | 11 | |
| β-strand | 525 | 1 | 6 |
| α-helix | 527-537 | 11 | |
| α-helix | 539-542 | 4 | |
| α-helix | 545-558 | 14 | |
| β-strand | 562-567 | 6 | 6 |
| β-strand | 570-575 | 6 | 6 |
| α-helix | 577-581 | 5 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 5'-d(*ap*ap*cp*tp*ap*tp*gp*ap*ap*ap*cp*ap*ap*ap*tp*tp*tp*tp*cp*cp*t)-3' | A, C | DNA | 21 | | |
| 5'-d(*tp*tp*ap*gp*gp*ap*ap*ap*ap*tp*tp*tp*gp*tp*tp*tp*cp*ap*tp*ap*g)-3' | B, D | DNA | 21 | | |
| Forkhead box protein P2 | F, G, H, I, J, K | protein | 93 | Homo sapiens | O15409 (AlphaFold model) |
Sequence of entity 1 (A, C), FASTA
>2A07_1 5'-D(*AP*AP*CP*TP*AP*TP*GP*AP*AP*AP*CP*AP*AP*AP*TP*TP*TP*TP*CP*CP*T)-3' (chains A, C)
AACTATGAAACAAATTTTCCT
Sequence of entity 2 (B, D), FASTA
>2A07_2 5'-D(*TP*TP*AP*GP*GP*AP*AP*AP*AP*TP*TP*TP*GP*TP*TP*TP*CP*AP*TP*AP*G)-3' (chains B, D)
TTAGGAAAATTTGTTTCATAG
Sequence of entity 3 (F, G, H, I, J, K), FASTA
>2A07_3 Forkhead box protein P2 (chains F, G, H, I, J, K)
IVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKC
FVRVENVKGAVWTVDEVEYQKRRSQKITGSPTL
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 6 |
Primary citation
Structure of the Forkhead Domain of FOXP2 Bound to DNA. Stroud, J.C., Wu, Y., Bates, D.L. et al. Structure (2006) 14:159-166. DOI 10.1016/j.str.2005.10.005 · PubMed
Other PDB entries of the same protein (UniProt O15409 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
Browse structure collections
About this viewer
MolViewer shows 2A07 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.