Structure of the human ubiquitin-conjugating enzyme E2 variant 1 (UEV-1). Determined by X-ray diffraction at 1.69 Å resolution. Released 12 Jul 2005.
Explore 2A4D in 3D Show helices and sheets RCSB PDB PDBe
2A4D contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 85-99 | 15 | |
| β-strand | 107-111 | 5 | 1 |
| β-strand | 121-127 | 7 | 1 |
| α-helix | 128-129 | 2 | |
| β-strand | 138-144 | 7 | 1 |
| α-helix | 153-154 | 2 | |
| β-strand | 155-158 | 4 | 1 |
| β-strand | 160 | 1 | 2 |
| β-strand | 167 | 1 | 3 |
| β-strand | 173 | 1 | 1 |
| β-strand | 174 | 1 | 3 |
| α-helix | 176-178 | 3 | |
| α-helix | 180-183 | 4 | |
| α-helix | 191-202 | 12 | |
| α-helix | 213-214 | 2 | |
| β-strand | 218 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-conjugating enzyme E2 variant 1 | A | protein | 160 | Homo sapiens | Q13404 (AlphaFold model) |
>2A4D_1 Ubiquitin-conjugating enzyme E2 variant 1 (chains A) MGSSHHHHHHSSGLVPRGSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTR WTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISV LAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN
A human ubiquitin conjugating enzyme (E2)-HECT E3 ligase structure-function screen. Sheng, Y., Hong, J.H., Doherty, R. et al. Mol Cell Proteomics (2012) 11:329-341. DOI 10.1074/mcp.O111.013706 · PubMed
Other PDB entries of the same protein (UniProt Q13404 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2A4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.