2A5T: NR1/NR2A ligand-binding cores complex

Crystal Structure Of The NR1/NR2A ligand-binding cores complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Nov 2005.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Rattus norvegicus, Canis lupus familiaris
Chains: 2
Atoms: 4,528
Mol. weight: 65.41 kDa
Ligands: GLU, GLY
Released: 15 Nov 2005

Explore 2A5T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A5T contains 28 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	13	1	2
β-strand	17	1	2
β-strand	18-21	4	1
α-helix	28-30	3
β-strand	32	1	3
β-strand	38	1	3
β-strand	42-46	5	1
β-strand	59-64	6	1
α-helix	66-77	12
β-strand	82-86	5	1
β-strand	95-97	3	4
β-strand	104-106	3	4
α-helix	108-115	8
β-strand	120-121	2	1
β-strand	126	1	5
α-helix	129-132	4
β-strand	135-137	3	1
β-strand	142-151	10	5
α-helix	162-165	4
β-strand	173-174	2	5
β-strand	176	1	6
α-helix	180-187	8
α-helix	189-191	3
α-helix	192-198	7
β-strand	203	1	6
α-helix	206-214	9
β-strand	220-224	5	5
α-helix	225-234	10
β-strand	238-250	13	5
β-strand	253-255	3	1
α-helix	261-273	13
α-helix	276-280	5
α-helix	281-285	5

Chain B: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	7
β-strand	16	1	8
β-strand	20	1	8
β-strand	21-24	4	7
α-helix	25-26	2
β-strand	37-44	8	7
β-strand	52-60	9	7
α-helix	62-74	13
β-strand	77-82	6	7
β-strand	91-92	2	9
β-strand	95-96	2	9
α-helix	98-104	7
β-strand	110-111	2	7
β-strand	116	1	10
α-helix	119-122	4
β-strand	125-127	3	7
β-strand	132-141	10	10
α-helix	152-155	4
α-helix	157-159	3
α-helix	163-164	2
β-strand	166-167	2	10
α-helix	173-181	9
α-helix	183-189	7
α-helix	190-192	3
α-helix	197-205	9
β-strand	211-215	5	10
α-helix	216-224	9
β-strand	231-233	3	10
β-strand	240-245	6	10
β-strand	248-250	3	7
α-helix	256-268	13
α-helix	271-275	5
α-helix	276-280	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N-methyl-D-aspartate receptor NMDAR1-4a subunit	A	protein	292	Rattus norvegicus, Canis lupus familiaris	P35439 (AlphaFold model)
N-methyl-D-aspartate receptor NMDAR2A subunit	B	protein	284	Rattus norvegicus	Q00959 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2A5T_1 N-methyl-D-aspartate receptor NMDAR1-4a subunit (chains A)
GMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVP
QCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADM
IVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSS
VDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVT
TGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS

Sequence of entity 2 (B), FASTA

>2A5T_2 N-methyl-D-aspartate receptor NMDAR2A subunit (chains B)
GPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGF
CIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERS
EVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNY
PYMHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFAT
TGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHN

Ligands and cofactors

ID	Name	Formula	Copies
GLU	Glutamic acid	C5 H9 N O4	1
GLY	Glycine	C2 H5 N O2	1

Primary citation

Subunit arrangement and function in NMDA receptors. Furukawa, H., Singh, S.K., Mancusso, R. et al. Nature (2005) 438:185-192. DOI 10.1038/nature04089 · PubMed

Other PDB entries of the same protein (UniProt P35439 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PB7 1.35 Å, Crystal structure of the NR1 ligand binding core in complex with glycine at 1.35 Å…
1Y20 1.4 Å, Crystal structure of the NR1 ligand-binding core in complex with ACPC
1PB8 1.45 Å, Crystal structure of the NR1 ligand binding core in complex with D-serine at 1.45 Å…
1Y1Z 1.5 Å, Crystal structure of the NR1 ligand binding core in complex with ACBC
5U8C 1.6 Å, Crystal structure of GLUN1/GLUN2A ligand-binding domain in complex with glycine and…
1PB9 1.6 Å, Crystal structure of the NR1 ligand binding core in complex with D-cycloserine at 1.60 Å…
6UZ6 1.66 Å, Crystal structure of GLUN1/GLUN2A-4M mutant ligand-binding domain in complex with…
5I57 1.7 Å, Glutamate- and glycine-bound GluN1/GluN2A agonist binding domains
9NYZ 1.71 Å, Crystal structure of DCKA/glutamate-bound GluN1/GluN2A agonist binding domains with…
1Y1M 1.8 Å, Crystal structure of the NR1 ligand binding core in complex with cycloleucine
4NF8 1.86 Å, Crystal structure of GluN1/GluN2A ligand-binding domain in complex with glycine and…
6UZR 1.87 Å, Crystal structure of GLUN1/GLUN2A ligand-binding domain in complex with glycine and…

Browse structure collections

About this viewer

MolViewer shows 2A5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.