Structure of the human hypothetical ubiquitin-conjugating enzyme, LOC55284. Determined by X-ray diffraction at 1.82 Å resolution. Released 6 Sept 2005.
Explore 2A7L in 3D Show helices and sheets RCSB PDB PDBe
2A7L contains 14 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -2-1 | 4 | |
| α-helix | 6-17 | 12 | |
| α-helix | 19-20 | 2 | |
| β-strand | 35-42 | 8 | 1 |
| α-helix | 43-44 | 2 | |
| β-strand | 53-60 | 8 | 1 |
| α-helix | 68-69 | 2 | |
| β-strand | 70-74 | 5 | 1 |
| β-strand | 81 | 1 | 2 |
| β-strand | 84 | 1 | 2 |
| β-strand | 89 | 1 | 1 |
| β-strand | 90 | 1 | 2 |
| α-helix | 93-95 | 3 | |
| α-helix | 105-115 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hypothetical ubiquitin-conjugating enzyme LOC55284 | A, B | protein | 136 | Homo sapiens | Q96B02 (AlphaFold model) |
>2A7L_1 Hypothetical ubiquitin-conjugating enzyme LOC55284 (chains A, B) MGSSHHHHHHSSGLVPRGSMASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDM EGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSP ALSVQSVCLSIISMLS
A human ubiquitin conjugating enzyme (E2)-HECT E3 ligase structure-function screen. Sheng, Y., Hong, J.H., Doherty, R. et al. Mol Cell Proteomics (2012) 11:329-341. DOI 10.1074/mcp.O111.013706 · PubMed
Other PDB entries of the same protein (UniProt Q96B02 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2A7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.