NMR structure of gamma herpesvirus 68 a viral Bcl-2 homolog. Determined by solution NMR. Released 16 May 2006.
Explore 2ABO in 3D Show helices and sheets RCSB PDB PDBe
2ABO contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-21 | 13 | |
| α-helix | 34-51 | 18 | |
| α-helix | 55-57 | 3 | |
| α-helix | 63-65 | 3 | |
| α-helix | 72-75 | 4 | |
| α-helix | 85-99 | 15 | |
| α-helix | 110-125 | 16 | |
| α-helix | 128-130 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| bcl-2 homolog | A | protein | 136 | Murid herpesvirus 4 | P89884 (AlphaFold model) |
>2ABO_1 bcl-2 homolog (chains A) MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADY GPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMT HFFIENNLMNHFPLED
A surface groove essential for viral Bcl-2 function during chronic infection in vivo. Loh, J., Huang, Q., Petros, A.M. et al. PLoS Pathog (2005) 1:e10-e10. DOI 10.1371/journal.ppat.0010010 · PubMed
Other PDB entries of the same protein (UniProt P89884 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2ABO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.