2ACF: Replicase polyprotein 1ab

NMR structure of SARS-CoV non-structural protein NSP3A (SARS1) from SARS coronavirus. Determined by X-ray diffraction at 1.4 Å resolution. Released 14 Feb 2006.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: SARS coronavirus Tor2
Chains: 4
Atoms: 6,502
Mol. weight: 79.87 kDa
Released: 14 Feb 2006

Explore 2ACF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ACF contains 43 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	192-193	2	1
β-strand	198-202	5	1
α-helix	205-212	8
β-strand	216-220	5	1
α-helix	230-238	9
α-helix	242-254	13
β-strand	262-266	5	1
β-strand	273-277	5	1
α-helix	282-284	3
α-helix	288-290	3
α-helix	291-296	6
α-helix	297-300	4
β-strand	303-306	4	1
α-helix	307-308	2
α-helix	312-314	3
α-helix	318-328	11
β-strand	332-337	6	1
α-helix	340-350	11

Chains B and D: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	191	1
β-strand	192-193	2	2
β-strand	198-202	5	2
α-helix	205-212	8
β-strand	216-220	5	2
α-helix	230-238	9
α-helix	242-254	13
β-strand	262-266	5	2
β-strand	273-277	5	2
α-helix	282-284	3
α-helix	290-296	7
α-helix	297-300	4
β-strand	303-306	4	2
α-helix	307-308	2
α-helix	312-314	3
α-helix	318-328	11
β-strand	332-337	6	2
α-helix	340-353	14

Chain C: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	192-193	2	3
β-strand	198-202	5	3
α-helix	205-212	8
β-strand	216-220	5	3
α-helix	230-238	9
α-helix	242-254	13
β-strand	262-266	5	3
β-strand	273-277	5	3
α-helix	288-290	3
α-helix	291-296	6
α-helix	297-300	4
β-strand	303-306	4	3
α-helix	307-308	2
α-helix	312-314	3
α-helix	318-328	11
β-strand	332-337	6	3
α-helix	340-354	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replicase polyprotein 1ab	A, B, C, D	protein	182	SARS coronavirus Tor2	P0C6X7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2ACF_1 Replicase polyprotein 1ab (chains A, B, C, D)
HHHHHHMPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALN
KATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYE
NFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKP
RV

Primary citation

Structural basis of severe acute respiratory syndrome coronavirus ADP-ribose-1''-phosphate dephosphorylation by a conserved domain of nsP3. Saikatendu, K.S., Joseph, J.S., Subramanian, V. et al. Structure (2005) 13:1665-1675. DOI 10.1016/j.str.2005.07.022 · PubMed

Other PDB entries of the same protein (UniProt P0C6X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W79 1.46 Å, Structure of SARS-CoV main protease bound to potent broad-spectrum non-covalent…
6WCO 1.48 Å, Structure of SARS main protease bound to inhibitor X47
5C5O 1.5 Å, Structure of SARS-3CL protease complex with a phenyl-beta-alanyl (S,R)-N-decalin type…
8CB3 1.57 Å, SARS-CoV Macro domain complexed with 3-(N-morpholino)propanesulfonic acid
3TNT 1.59 Å, Crystal structure of SARS coronavirus main protease complexed with an alpha,…
4TWY 1.6 Å, Structure of SARS-3CL protease complex with a phenylbenzoyl (S,R)-N-decalin type inhibitor
7FA1 1.6 Å, Crystal Structure of N-terminus of the non-structural protein 2 from SARS coronavirus
5N19 1.62 Å, Structure of SARS coronavirus main protease in complex with the alpha-ketoamide…
2ZU5 1.65 Å, complex structure of SARS-CoV 3CL protease with TG-0205486
8UFM 1.65 Å, Crystal Structure of L516C/Y647C Mutant of SARS-Unique Domain (SUD) from SARS-CoV-2
3SZN 1.69 Å, Crystal structure of SARS coronavirus main protease complexed with an alpha,…
5C5N 1.69 Å, Structure of SARS-3CL protease complex with a phenyl-beta-alanyl (R,S)-N-decalin type…

Browse structure collections

About this viewer

MolViewer shows 2ACF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.