Crystal Structure of a glycosylated Fab from an IgM cryoglobulin with properties of a natural proteolytic antibody. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 May 2006.
Explore 2AGJ in 3D Show helices and sheets RCSB PDB PDBe
2AGJ contains 14 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 6 |
| β-strand | 11 | 1 | 7 |
| β-strand | 17-25 | 9 | 6 |
| β-strand | 35-41 | 7 | 8 |
| β-strand | 48-54 | 7 | 8 |
| α-helix | 55-57 | 3 | |
| β-strand | 59-61 | 3 | 8 |
| α-helix | 63-65 | 3 | |
| β-strand | 69-72 | 4 | 6 |
| β-strand | 79-85 | 7 | 6 |
| α-helix | 89-91 | 3 | |
| β-strand | 93-100 | 8 | 8 |
| β-strand | 109-110 | 2 | 8 |
| β-strand | 115-116 | 2 | 8 |
| β-strand | 117 | 1 | 7 |
| α-helix | 124-126 | 3 | |
| β-strand | 127 | 1 | 9 |
| β-strand | 130-132 | 3 | 10 |
| β-strand | 142-147 | 6 | 10 |
| β-strand | 150 | 1 | 9 |
| β-strand | 152 | 1 | 11 |
| β-strand | 159-162 | 4 | 12 |
| β-strand | 173-174 | 2 | 10 |
| α-helix | 175-177 | 3 | |
| β-strand | 178-180 | 3 | 11 |
| β-strand | 183-185 | 3 | 11 |
| β-strand | 188-193 | 6 | 10 |
| α-helix | 194-197 | 4 | |
| β-strand | 204-209 | 6 | 12 |
| β-strand | 211 | 1 | 13 |
| β-strand | 214 | 1 | 13 |
| β-strand | 219-221 | 3 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 30-32 | 3 | |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 46-50 | 5 | 2 |
| β-strand | 54-55 | 2 | 2 |
| β-strand | 63-68 | 6 | 1 |
| β-strand | 71-77 | 7 | 1 |
| α-helix | 81-83 | 3 | |
| β-strand | 86-91 | 6 | 2 |
| β-strand | 98-99 | 2 | 2 |
| β-strand | 103-107 | 5 | 2 |
| β-strand | 112 | 1 | 3 |
| α-helix | 113-114 | 2 | |
| β-strand | 115-119 | 5 | 4 |
| α-helix | 120-122 | 3 | |
| α-helix | 123-127 | 5 | |
| β-strand | 130-140 | 11 | 4 |
| β-strand | 141 | 1 | 3 |
| β-strand | 146-151 | 6 | 5 |
| β-strand | 154-155 | 2 | 5 |
| α-helix | 156 | 1 | |
| β-strand | 160 | 1 | 4 |
| β-strand | 163-164 | 2 | 4 |
| α-helix | 165-168 | 4 | |
| β-strand | 174-183 | 10 | 4 |
| α-helix | 184-188 | 5 | |
| β-strand | 192-198 | 7 | 5 |
| β-strand | 206-211 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Yvo Fab, Light Chain | L | protein | 215 | Homo sapiens | Q6PJF2 (AlphaFold model) |
| Yvo Fab, Heavy Chain | H | protein | 226 | Homo sapiens | P01871 (AlphaFold model) |
>2AGJ_1 Yvo Fab, Light Chain (chains L) EIVLTQSPGTLSLSPGERATLSCRASETVSNDKVAWYQQKPGQAPRLLIYGASSRATGIP DRFSGSGSGTDFTLSISGLEPEDFVVYYCQQYASSPRTFGQGTKVEIKRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>2AGJ_2 Yvo Fab, Heavy Chain (chains H) QVTLKESGPTLVKPTQTLTLTCTFSGFSLTTTGEGVGWIRQPPGKALEFLAFIYWNDAKR YNPSLQSRLTITKDASKKQVVLTLTNLDPVDTATYYCARTSGWDIEFEYWGQGTLVTVSS GSASAPTLFPLVSCENSSPSSTVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLR GGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKDVPLPVVI
Crystal structure of a glycosylated Fab from an IgM cryoglobulin with properties of a natural proteolytic antibody. Ramsland, P.A., Terzyan, S.S., Cloud, G. et al. Biochem J (2006) 395:473-481. DOI 10.1042/BJ20051739 · PubMed
Other PDB entries of the same protein (UniProt Q6PJF2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AGJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.