Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the Bcr protein. Determined by solution NMR. Released 18 Jul 2006.
Explore 2AIN in 3D Show helices and sheets RCSB PDB PDBe
2AIN contains 2 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-12 | 8 | 1 |
| β-strand | 19-24 | 6 | 2 |
| β-strand | 33-39 | 7 | 2 |
| α-helix | 44-48 | 5 | |
| β-strand | 56-60 | 5 | 1 |
| β-strand | 63-64 | 2 | 1 |
| α-helix | 70-78 | 9 | |
| β-strand | 83-90 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 101-103 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Afadin | A | protein | 93 | Homo sapiens | P55196 (AlphaFold model) |
| 6-mer peptide from Breakpoint cluster region protein | B | protein | 6 | P11274 (AlphaFold model) |
>2AIN_1 Afadin (chains A) MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSV DGRSLVGLSQERAAELMTRTSSVVTLEVAKQGA
>2AIN_2 6-mer peptide from Breakpoint cluster region protein (chains B) LFSTEV
Solution structure and backbone dynamics of the AF-6 PDZ domain/Bcr peptide complex. Chen, Q., Niu, X., Xu, Y. et al. Protein Sci (2007) 16:1053-1062. DOI 10.1110/ps.062440607 · PubMed
Other PDB entries of the same protein (UniProt P55196 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AIN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.