2APT: T-cell receptor beta chain V

Crystal Structure of the G17E/S54N/K66E/Q72H/E80V/L81S/T87S/G96V variant of the murine T cell receptor V beta 8.2 domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Mar 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,764
Mol. weight: 24.42 kDa
Ligands: MLA
Released: 21 Mar 2006

Explore 2APT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2APT contains 2 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	31-38	8	2
β-strand	42-49	8	2
β-strand	56-57	2	2
β-strand	65-68	4	1
β-strand	74-79	6	1
α-helix	84-86	3
β-strand	88-96	9	2
β-strand	99-108	4	2
β-strand	112-116	5	2

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	3
β-strand	10-13	4	4
β-strand	19-25	7	3
β-strand	31-38	8	4
β-strand	42-49	8	4
β-strand	56-57	2	4
β-strand	65-71	7	3
β-strand	74-79	6	3
α-helix	84-86	3
β-strand	88-95	8	4
β-strand	101-108	2	4
β-strand	112-116	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell receptor beta chain V	A, B	protein	112	Rattus norvegicus	P04213 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2APT_1 T-cell receptor beta chain V (chains A, B)
ILEAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKG
DIPDGYEASRPSHEQFSLILVSATPSQSSVYFCASGVGGTLYFGAGTRLSVL

Ligands and cofactors

ID	Name	Formula	Copies
MLA	Malonic acid	C3 H4 O4	1

Primary citation

Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction. Cho, S., Swaminathan, C.P., Yang, J. et al. Structure (2005) 13:1775-1787. DOI 10.1016/j.str.2005.08.015 · PubMed

Other PDB entries of the same protein (UniProt P04213 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M02 1.75 Å, Crystal structure of murine P14 TCR / H-2Db with PF, modified gp33 peptide from LCMV
2APB 1.8 Å, Crystal Structure of the S54N variant of murine T cell receptor Vbeta 8.2 domain
2APF 1.8 Å, Crystal Structure of the A52V/S54N/K66E variant of the murine T cell receptor V beta 8.2…
2APX 1.8 Å, Crystal Structure of the G17E/A52V/S54N/K66E/Q72H/E80V/L81S/T87S/G96V variant of the…
2AQ2 1.8 Å, Crystal structure of T-cell receptor V beta domain variant complexed with superantigen…
6G9Q 1.89 Å, Ternary complex of P14 TCR with murine MHC class I H-2 Db in complex with self-antigen…
2APV 1.9 Å, Crystal Structure of the G17E/A52V/S54N/Q72H/E80V/L81S/T87S/G96V variant of the murine T…
5M00 1.95 Å, Crystal structure of murine P14 TCR complex with H-2Db and Y4A, modified gp33 peptide…
5M01 1.95 Å, Crystal structure of murine P14 TCR/ H-2Db complex with PA, modified gp33 peptide from…
1LP9 2.0 Å, Xenoreactive complex AHIII 12.2 TCR bound to p1049/HLA-A2.1
2APW 2.0 Å, Crystal Structure of the G17E/A52V/S54N/K66E/E80V/L81S/T87S/G96V variant of the murine T…
2AQ1 2.1 Å, Crystal structure of T-cell receptor V beta domain variant complexed with superantigen…

Browse structure collections

About this viewer

MolViewer shows 2APT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.