2ARJ: CD8alpha-alpha

CD8alpha-alpha in complex with YTS 105.18 Fab. Determined by X-ray diffraction at 2.88 Å resolution. Released 30 May 2006.

Method: X-ray diffraction
Resolution: 2.88 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 6
Atoms: 8,334
Mol. weight: 120.68 kDa
Released: 30 May 2006

Explore 2ARJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ARJ contains 36 α-helices and 108 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and L: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	12
β-strand	10-14	5	13
β-strand	19-25	7	12
β-strand	33-38	6	13
β-strand	45-49	5	13
β-strand	53-54	2	13
α-helix	55	1
β-strand	62-67	6	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	84-90	7	13
α-helix	97	1
β-strand	98	1	13
α-helix	99	1
β-strand	102-107	6	13
β-strand	111	1	14
α-helix	112-113	2
β-strand	114-118	5	15
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	15
β-strand	140	1	14
β-strand	145-150	6	16
β-strand	153-155	3	16
β-strand	159-163	5	15
α-helix	164-167	4
β-strand	173-182	10	15
α-helix	183-186	4
β-strand	191-198	8	16
β-strand	201-210	10	16

Chain B: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	17
β-strand	11-12	2	18
α-helix	17	1
β-strand	18-25	8	17
β-strand	33-39	7	19
β-strand	46-51	6	19
β-strand	57-59	3	19
α-helix	64-66	3
β-strand	67-72	6	17
α-helix	73-75	3
β-strand	77-82	6	17
α-helix	84-86	3
β-strand	88-95	8	19
β-strand	107-109	3	19
β-strand	110-111	2	18
α-helix	115-116	2
β-strand	117	1	20
α-helix	118-119	2
β-strand	120-124	5	21
β-strand	138-147	10	21
β-strand	148	1	20
β-strand	153-157	4	22
α-helix	162-164	3
β-strand	166	1	22
β-strand	172-173	2	21
β-strand	177-181	3	21
β-strand	184-193	10	21
β-strand	204-212	6	22
α-helix	213-215	3
β-strand	217-222	6	22

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	18-25	8	6
β-strand	33-39	7	8
β-strand	46-51	6	8
β-strand	57-59	3	8
α-helix	64-66	3
β-strand	67-72	6	6
α-helix	73-75	3
β-strand	77-82	6	6
α-helix	84-86	3
β-strand	88-95	8	8
β-strand	107-109	3	8
β-strand	110-111	2	7
α-helix	115-116	2
β-strand	117	1	9
α-helix	118-119	2
β-strand	120-124	5	10
β-strand	138-147	10	10
β-strand	148	1	9
β-strand	153-157	4	11
α-helix	162-164	3
β-strand	166	1	11
β-strand	172-173	2	10
α-helix	174-176	3
β-strand	177-181	3	10
β-strand	184-193	10	10
β-strand	204-212	6	11
α-helix	213-215	3
β-strand	217-222	6	11

Chains Q and R: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	25
β-strand	14-16	3	26
α-helix	17	1
β-strand	22-28	7	25
β-strand	36-42	7	26
β-strand	51-56	6	26
β-strand	63-65	3	26
β-strand	75-79	5	25
β-strand	84-89	6	25
β-strand	98-106	9	26
β-strand	109-112	4	26
β-strand	116-120	5	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
YTS 105.18 antigen binding region Light chain	A, L	protein	211	Rattus norvegicus	P01836 (AlphaFold model)
YTS 105.18 antigen binding region Heavy chain	B, H	protein	215	Rattus norvegicus	P20761 (AlphaFold model)
T-cell surface glycoprotein CD8 alpha chain	Q, R	protein	123	Mus musculus	P01731 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>2ARJ_1 YTS 105.18 antigen binding region Light chain (chains A, L)
DIVMTQSPSSLAVSAGERVTLNCKASQNVRNNIAWYQQKPGQSPKLLIYYASYRYTGVPD
RFTGDGFGTDFTLAINSVQADDAAFYYCQRIYNSPYTFGAGTKLELIRADAAPTVSIFPP
SMEQLTSGGASVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLS
LTKVEYERHNLYTCEVVHKTSSSPVVKSFNR

Sequence of entity 2 (B, H), FASTA

>2ARJ_2 YTS 105.18 antigen binding region Heavy chain (chains B, H)
QVQLKESGPGLVQPSQTLSLTCTVSGFSLTSNSVHWVRQPPGKGLEWMGGIWGDGDTDYN
SALKSRLSISRDTSKNQVFLKMNSLQTDDTAIYFCTPLIGSWYFDFWGPGTMVTASSAQT
TAPSVYPLAPGCGDTTSSTVTLGCLVKGYFPEPVTVTWNSGALSSDVHTFPAVLQSGLYT
LTSSVTSSTWPSQTVTCNVAHPASSTKVDQKIVPR

Sequence of entity 3 (Q, R), FASTA

>2ARJ_3 T-cell surface glycoprotein CD8 alpha chain (chains Q, R)
KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSH
NKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQ
KVN

Primary citation

Crystal structure of the TCR co-receptor CD8alphaalpha in complex with monoclonal antibody YTS 105.18 Fab fragment at 2.88 A resolution. Shore, D.A., Teyton, L., Dwek, R.A. et al. J Mol Biol (2006) 358:347-354. DOI 10.1016/j.jmb.2006.02.016 · PubMed

Other PDB entries of the same protein (UniProt P01836 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3B9K 2.7 Å, Crystal structure of CD8alpha-beta in complex with YTS 156.7 FAB

Browse structure collections

About this viewer

MolViewer shows 2ARJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.