2AUC: Myosin A Tail Interacting Protein

Structure of the Plasmodium MTIP-MyoA complex, a key component of the parasite invasion motor. Determined by X-ray diffraction at 2.6 Å resolution. Released 17 Jan 2006.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Plasmodium knowlesi
Chains: 4
Atoms: 3,028
Mol. weight: 46.28 kDa
Released: 17 Jan 2006

Explore 2AUC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AUC contains 22 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	93-102	10
α-helix	109-119	11
α-helix	125-152	28
β-strand	159-161	3	1
α-helix	162-169	8
α-helix	178-188	11
β-strand	193-195	3	1
α-helix	196-200	5

Chain B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	91-92	2	2
α-helix	93-101	9
α-helix	106-108	3
α-helix	109-119	11
β-strand	122-123	2	2
α-helix	125-151	27
α-helix	162-167	6
α-helix	168-172	5
α-helix	178-185	8
α-helix	196-199	4

Chain C: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	92	1	3
α-helix	93-102	10
α-helix	109-119	11
β-strand	122	1	3
α-helix	125-150	26
β-strand	159-161	3	4
α-helix	162-171	10
α-helix	175-177	3
α-helix	178-188	11
β-strand	193-195	3	4
α-helix	196-203	8

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	804-813	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin A Tail Interacting Protein	A, B, C	protein	126	Plasmodium knowlesi	D0VWV5 (AlphaFold model)
Myosin A	D	protein	15		Q7RQ71 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2AUC_1 Myosin A Tail Interacting Protein (chains A, B, C)
KDMFNTKSSNGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHD
RDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKL
FCEDIL

Sequence of entity 2 (D), FASTA

>2AUC_2 Myosin A (chains D)
SLMRVQAHIRKRMVA

Primary citation

Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Bosch, J., Turley, S., Daly, T.M. et al. Proc Natl Acad Sci U S A (2006) 103:4852-4857. DOI 10.1073/pnas.0510907103 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2AUC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.