Structure of human Ubiquitin-conjugating enzyme E2 G1. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Sept 2005.
Explore 2AWF in 3D Show helices and sheets RCSB PDB PDBe
2AWF contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| α-helix | 7-19 | 13 | |
| β-strand | 25-29 | 5 | 1 |
| β-strand | 37-43 | 7 | 1 |
| α-helix | 44-45 | 2 | |
| β-strand | 54-60 | 7 | 1 |
| β-strand | 71-74 | 4 | 1 |
| β-strand | 83 | 1 | 2 |
| β-strand | 88 | 1 | 1 |
| β-strand | 89 | 1 | 2 |
| α-helix | 92-94 | 3 | |
| α-helix | 117-128 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-conjugating enzyme E2 G1 | A | protein | 172 | Homo sapiens | P62253 (AlphaFold model) |
>2AWF_1 Ubiquitin-conjugating enzyme E2 G1 (chains A) MGSSHHHHHHSSGLVPRGSLLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDT LYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPE ERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARC
A human ubiquitin conjugating enzyme (E2)-HECT E3 ligase structure-function screen. Sheng, Y., Hong, J.H., Doherty, R. et al. Mol Cell Proteomics (2012) 11:329-341. DOI 10.1074/mcp.O111.013706 · PubMed
Other PDB entries of the same protein (UniProt P62253 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2AWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.