2B0O: UPLC1 GAP domain

Crystal structure of UPLC1 GAP domain. Determined by X-ray diffraction at 2.06 Å resolution. Released 20 Sept 2005.

Method: X-ray diffraction
Resolution: 2.06 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,492
Mol. weight: 131.4 kDa
Ligands: ZN
Released: 20 Sept 2005

Explore 2B0O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2B0O contains 65 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 15 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	424-433	10
β-strand	440	1	1
β-strand	447	1	1
β-strand	451-453	3	2
β-strand	458-460	3	2
α-helix	462-471	10
β-strand	478-480	3	2
α-helix	488-496	9
α-helix	499-506	8
α-helix	524-535	12
α-helix	542-543	2
α-helix	548-556	9
α-helix	560-568	9
α-helix	576	1
β-strand	577-578	2	3
β-strand	586-587	2	3
α-helix	589-595	7
α-helix	602-611	10
α-helix	625-631	7
α-helix	635-643	9
α-helix	658-665	8
α-helix	668-680	13

Chain F: 18 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	425-434	10
β-strand	440	1	4
β-strand	447	1	4
β-strand	451-453	3	5
β-strand	458-460	3	5
α-helix	462-471	10
β-strand	478-480	3	5
α-helix	488-491	4
α-helix	492-496	5
α-helix	499-506	8
α-helix	524-535	12
α-helix	542-543	2
α-helix	549-557	9
α-helix	560-568	9
β-strand	577	1	6
β-strand	587	1	6
α-helix	589-595	7
α-helix	599-601	3
α-helix	602-611	10
α-helix	625-631	7
α-helix	635-643	9
α-helix	646-648	3
α-helix	658-665	8
α-helix	668-678	11
β-strand	689	1	7
α-helix	690-696	7

Chain G: 18 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	423-433	11
β-strand	440	1	8
β-strand	447	1	8
β-strand	451-453	3	9
β-strand	458-460	3	9
α-helix	462-471	10
β-strand	478-480	3	9
α-helix	488-496	9
α-helix	499-506	8
α-helix	524-532	9
α-helix	533-537	5
α-helix	548-556	9
α-helix	560-568	9
α-helix	576	1
β-strand	577	1	10
α-helix	578	1
β-strand	587	1	10
α-helix	589-596	8
α-helix	599-601	3
α-helix	602-611	10
α-helix	625-631	7
α-helix	635-643	9
α-helix	646-647	2
α-helix	658-665	8
α-helix	668-680	13

Chain H: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	425-434	10
β-strand	440	1	11
β-strand	447	1	11
β-strand	451-453	3	12
β-strand	458-460	3	12
α-helix	462-471	10
β-strand	478-480	3	12
α-helix	492-496	5
α-helix	499-506	8
α-helix	524-535	12
α-helix	548-556	9
α-helix	560-568	9
β-strand	577	1	13
β-strand	587	1	13
α-helix	589-595	7
α-helix	599-601	3
α-helix	602-611	10
α-helix	625-631	7
α-helix	635-643	9
α-helix	658-664	7
α-helix	668-681	14
β-strand	687	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UPLC1	E, F, G, H	protein	301	Homo sapiens	Q8TDY4 (AlphaFold model)

Sequence of entity 1 (E, F, G, H), FASTA

>2B0O_1 UPLC1 (chains E, F, G, H)
MGSSHHHHHHSSGLVPRGSGHDGEPHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNL
GVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGP
KPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQP
LPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPD
CLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVIST
E

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structural analysis of GAP and ankyrin domains of UPLC1. Ismail, S., Shen, L., Arrowsmith, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q8TDY4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9JIH 2.8 Å, Crystal structure of BAR domain of ACAP4
3LVQ 3.38 Å, The crystal structure of ASAP3 in complex with Arf6 in transition state
3LVR 3.38 Å, The crystal structure of ASAP3 in complex with Arf6 in transition state soaked with…

Browse structure collections

About this viewer

MolViewer shows 2B0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.