Crystal structure of cytochrome C from bovine heart at 1.5 A resolution. Determined by X-ray diffraction at 1.5 Å resolution. Released 11 Oct 2005.
Explore 2B4Z in 3D Show helices and sheets RCSB PDB PDBe
2B4Z contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-13 | 11 | |
| α-helix | 24-26 | 3 | |
| β-strand | 39 | 1 | 1 |
| α-helix | 50-54 | 5 | |
| β-strand | 58 | 1 | 1 |
| α-helix | 61-67 | 7 | |
| α-helix | 71-74 | 4 | |
| α-helix | 88-101 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome c | A | protein | 104 | Bos taurus | P62894 (AlphaFold model) |
>2B4Z_1 Cytochrome c (chains A) GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWG EETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
High resolution X-ray crystallographic structure of bovine heart cytochrome c and its application to the design of an electron transfer biosensor. Mirkin, N., Jaconcic, J., Stojanoff, V. et al. Proteins (2008) 70:83-92. DOI 10.1002/prot.21452 · PubMed
Other PDB entries of the same protein (UniProt P62894 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2B4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.