2BE4: Hypothetical protein LOC449832

X-ray structure an ef-hand protein from danio rerio Dr.36843. Determined by X-ray diffraction at 2.1 Å resolution. Released 1 Nov 2005.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Danio rerio
Chains: 1
Atoms: 2,445
Mol. weight: 32.05 kDa
Released: 1 Nov 2005

Explore 2BE4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BE4 contains 18 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	10-20	11
β-strand	27-29	3	1
α-helix	30-32	3
α-helix	33-44	12
α-helix	52-62	11
α-helix	65-68	4
β-strand	73-75	3	1
α-helix	76-83	8
α-helix	86-97	12
α-helix	103-113	11
β-strand	120-122	3	2
α-helix	123-125	3
α-helix	126-136	11
α-helix	143-157	15
β-strand	164-166	3	2
α-helix	167-170	4
α-helix	171-173	3
α-helix	188-205	18
β-strand	212-214	3	3
α-helix	216-229	14
α-helix	235-249	15
β-strand	256-258	3	3
α-helix	259-265	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hypothetical protein LOC449832	A	protein	272	Danio rerio	Q5XJX1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BE4_1 hypothetical protein LOC449832 (chains A)
SDSAFANLDAAGFLQIWQHFDADDNGYIEGKELDDFFRHMLKKLQPKDKITDERVQQIKK
SFMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWRKYDADSSGY
ISAAELKNFLKDLFLQHKKKIPPNKLDEYTDAMMKIFDKNKDGRLDLNDLARILALQENF
LLQFKMDASSQVERKRDFEKIFAHYDVSRTGALEGPEVDGFVKDMMELVRPSISGGDLDK
FRECLLTHCDMNKDGKIQKSELALCLGLKHKP

Primary citation

X-ray structure of Danio rerio secretagogin: A hexa-EF-hand calcium sensor. Bitto, E., Bingman, C.A., Bittova, L. et al. Proteins (2009) 76:477-483. DOI 10.1002/prot.22362 · PubMed

Other PDB entries of the same protein (UniProt Q5XJX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Q4U 2.1 Å, Ensemble refinement of the crystal structure of an EF-hand protein from Danio rerio…
6JLH 2.37 Å, Structure of SCGN in complex with a Snap25 peptide

Browse structure collections

About this viewer

MolViewer shows 2BE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.