2BEC: CHP2

Crystal structure of CHP2 in complex with its binding region in NHE1 and insights into the mechanism of pH regulation. Determined by X-ray diffraction at 2.7 Å resolution. Released 27 Jun 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,674
Mol. weight: 28.51 kDa
Ligands: YT3
Released: 27 Jun 2006

Explore 2BEC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BEC contains 15 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	17-21	5
α-helix	25-38	14
α-helix	48-52	5
α-helix	55-59	5
α-helix	63-68	6
α-helix	80-87	8
α-helix	88-90	3
α-helix	92-94	3
α-helix	95-98	4
α-helix	112-123	12
β-strand	130-131	2	1
α-helix	133-142	10
α-helix	150-164	15
β-strand	172-173	2	1
α-helix	174-179	6
α-helix	186-189	4

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	518-538	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcineurin B homologous protein 2	A	protein	202	Homo sapiens	O43745 (AlphaFold model)
Sodium/hydrogen exchanger 1	B	protein	43	Homo sapiens	P19634 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BEC_1 Calcineurin B homologous protein 2 (chains A)
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVN
PLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAF
QLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKS
LEKMDVEQKMSIRILKHHHHHH

Sequence of entity 2 (B), FASTA

>2BEC_2 Sodium/hydrogen exchanger 1 (chains B)
VDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHH

Ligands and cofactors

ID	Name	Formula	Copies
YT3	Yttrium (III) ion	Y	2

Primary citation

Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation. Ben Ammar, Y., Takeda, S., Hisamitsu, T. et al. EMBO J (2006) 25:2315-2325. DOI 10.1038/sj.emboj.7601145 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2BEC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.