NEDD8 NEDP1 complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Sept 2005.
Explore 2BKR in 3D Show helices and sheets RCSB PDB PDBe
2BKR contains 18 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-8 | 5 | 1 |
| β-strand | 11-14 | 4 | 1 |
| α-helix | 15-19 | 5 | |
| α-helix | 26-27 | 2 | |
| β-strand | 28 | 1 | 2 |
| α-helix | 29-38 | 10 | |
| α-helix | 39-43 | 5 | |
| α-helix | 45-47 | 3 | |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-64 | 9 | |
| α-helix | 68-75 | 8 | |
| α-helix | 76-78 | 3 | |
| α-helix | 80-82 | 3 | |
| β-strand | 85-91 | 7 | 3 |
| β-strand | 99 | 1 | 4 |
| β-strand | 103-109 | 7 | 3 |
| α-helix | 110-112 | 3 | |
| β-strand | 114-118 | 5 | 3 |
| α-helix | 126-140 | 15 | |
| α-helix | 145-147 | 3 | |
| β-strand | 149-151 | 3 | 3 |
| α-helix | 155-157 | 3 | |
| α-helix | 163-179 | 17 | |
| α-helix | 186-189 | 4 | |
| α-helix | 192-210 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-7 | 7 | 5 |
| β-strand | 12-17 | 6 | 5 |
| β-strand | 22 | 1 | 6 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 5 |
| β-strand | 48-49 | 2 | 5 |
| β-strand | 55 | 1 | 6 |
| β-strand | 66-71 | 6 | 5 |
| β-strand | 73 | 1 | 4 |
| β-strand | 74 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sentrin-specific protease 8 | A | protein | 212 | HOMO SAPIENS | Q96LD8 (AlphaFold model) |
| Neddylin | B | protein | 77 | HOMO SAPIENS | Q15843 (AlphaFold model) |
>2BKR_1 SENTRIN-SPECIFIC PROTEASE 8 (chains A) MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDSSDHVSFISPEVTQ FIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGSHWSLLVYLQDKNSFFHYDS HSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFR QQTESLLQLLTPAYITKKRGEWKDLIATLAKK
>2BKR_2 NEDDYLIN (chains B) SMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADY KILGGSVLHLVLALRGG
Structural Basis of Nedd8 Ubiquitin Discrimination by the Deneddylating Enzyme Nedp1. Shen, L.N., Liu, H., Dong, C. et al. EMBO J (2005) 24:1341. DOI 10.1038/SJ.EMBOJ.7600628 · PubMed
Other PDB entries of the same protein (UniProt Q96LD8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BKR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.