2BOU: PDB entry 2BOU

Name: PDB 2BOU: EGF Domains 1,2,5 of human EMR2, a 7-TM immune system molecule, in complex with barium.
Published: 2006-10-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: immune system

EGF Domains 1,2,5 of human EMR2, a 7-TM immune system molecule, in complex with barium. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Oct 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,152
Mol. weight: 16.08 kDa
Ligands: CAC, CA, BA
Released: 18 Oct 2006

Explore 2BOU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BOU contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	9-10	2
β-strand	13-15	3	1
β-strand	21-23	3	1
α-helix	24	1
β-strand	27-28	2	2
β-strand	34	1	1
β-strand	42-43	2	2
α-helix	44	1
α-helix	46-48	3
β-strand	59-63	5	3
β-strand	68-72	5	3
α-helix	73	1
β-strand	76-78	3	4
β-strand	85	1	3
α-helix	88-90	3
β-strand	93-95	3	4
α-helix	98-101	4
β-strand	111-114	4	5
β-strand	119-122	4	5
β-strand	129	1	6
α-helix	130	1
β-strand	137	1	5
β-strand	142	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Egf-like module containing mucin-like hormone receptor-like 2 precursor	A	protein	143	HOMO SAPIENS	P48960 (AlphaFold model), Q9UHX3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BOU_1 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE RECEPTOR-LIKE 2 PRECURSOR (chains A)
DSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSD
CWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECSSGQHQCDSSTVCFNTVGSYS
CRCRPGWKPRHGIPNNQKDTVCE

Ligands and cofactors

ID	Name	Formula	Copies
CAC	Cacodylate ion	C2 H6 As O2	1
CA	Calcium ion	Ca	2
BA	Barium ion	Ba	2

Primary citation

Structural and Functional Characterization of a Novel T Cell Receptor Co-Regulatory Protein Complex, Cd97-Cd55. Abbott, R.J.M., Spendlove, I., Roversi, P. et al. J Biol Chem (2007) 282:22023. DOI 10.1074/JBC.M702588200 · PubMed

Other PDB entries of the same protein (UniProt P48960 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IKL 2.33 Å, Cryo-EM structure of the CD97-G13 complex
7YDM 2.89 Å, Cryo-EM structure of CD97/Gq complex
7YDJ 3.03 Å, Cryo EM structure of CD97/miniG12 complex
7YDH 3.1 Å, Cryo EM structure of CD97/miniG13 complex
7YDP 3.1 Å, Cryo-EM structure of CD97/miniGs complex
9MQR 3.16 Å, A8 Fab in complex with CD97
7DO4 3.2 Å, Crystal structure of CD97-CD55 complex
8IKJ 3.2 Å, Cryo-EM structure of the inactive CD97

Browse structure collections

About this viewer

MolViewer shows 2BOU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.