2BQZ: SET8 protein

Name: PDB 2BQZ: Crystal structure of a ternary complex of the human histone methyltransferase Pr-SET7 (also known as SET8)
Published: 2005-06-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of a ternary complex of the human histone methyltransferase Pr-SET7 (also known as SET8). Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Jun 2005.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 3,437
Mol. weight: 40.29 kDa
Ligands: SAH
Released: 8 Jun 2005

Explore 2BQZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BQZ contains 16 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	195-212	18
β-strand	218-223	6	1
β-strand	227-232	6	1
β-strand	236	1	2
β-strand	241-245	5	3
β-strand	248-251	4	4
α-helix	252-263	12
β-strand	272-277	6	4
β-strand	280-285	6	4
α-helix	294-296	3
α-helix	297	1
β-strand	298-299	2	5
β-strand	305-312	8	3
β-strand	315-322	8	3
β-strand	326	1	2
α-helix	330	1
β-strand	331	1	1
α-helix	332	1
β-strand	333-334	2	5
α-helix	341-346	6
α-helix	348-351	4

Chains B and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	20-21	2	4

Chain E: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	195-212	18
β-strand	218-223	6	6
β-strand	227-232	6	6
β-strand	236	1	7
β-strand	241-244	4	8
β-strand	248-251	4	9
α-helix	252-263	12
β-strand	272-277	6	9
β-strand	280-285	6	9
α-helix	294-296	3
α-helix	297	1
β-strand	298-299	2	10
β-strand	305-312	8	8
β-strand	315-322	8	8
β-strand	326	1	7
α-helix	330	1
β-strand	331	1	6
α-helix	332	1
β-strand	333-334	2	10
α-helix	341-346	6
α-helix	348-351	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SET8 protein	A, E	protein	161	HOMO SAPIENS	Q9NQR1 (AlphaFold model)
Histone H4	B, F	protein	10	HOMO SAPIENS	Q6GMV2 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>2BQZ_1 SET8 PROTEIN (chains A, E)
RKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIE
ITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHD
IDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Sequence of entity 2 (B, F), FASTA

>2BQZ_2 HISTONE H4 (chains B, F)
RHRKVLRDNY

Ligands and cofactors

ID	Name	Formula	Copies
SAH	S-adenosyl-L-homocysteine	C14 H20 N6 O5 S	2

Primary citation

Specificity and Mechanism of the Histone Methyltransferase Pr-Set7. Xiao, B., Jing, C., Kelly, G. et al. Genes Dev (2005) 19:1444. DOI 10.1101/GAD.1315905 · PubMed

Other PDB entries of the same protein (UniProt Q9NQR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3F9X 1.25 Å, Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases,…
5TEG 1.3 Å, Crystal structure of hSETD8 in complex with histone H4K20 norleucine mutant peptide and…
1ZKK 1.45 Å, Crystal structure of hSET8 in ternary complex with H4 peptide (16-24) and AdoHcy
3F9Y 1.5 Å, Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases,…
3F9W 1.6 Å, Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases,…
3F9Z 1.6 Å, Structural Insights into Lysine Multiple Methylation by SET Domain Methyltransferases,…
5W1Y 1.7 Å, SETD8 in complex with a covalent inhibitor
5TH7 1.95 Å, Complex of SETD8 with MS453
4IJ8 2.0 Å, Crystal structure of the complex of SETD8 with SAM
5V2N 2.0 Å, Crystal Structure of APO Human SETD8
9CR7 2.05 Å, Structure of human SETD8 in complex with covalent inhibitor AM2928
5T5G 2.1 Å, human SETD8 in complex with MS2177

Browse structure collections

About this viewer

MolViewer shows 2BQZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.