2BV3: Elongation factor G

Name: PDB 2BV3: Crystal structure of a mutant elongation factor G trapped with a GTP analogue
Published: 2005-08-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: elongation factor

Crystal structure of a mutant elongation factor G trapped with a GTP analogue. Determined by X-ray diffraction at 2.5 Å resolution. Released 10 Aug 2005.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: THERMUS THERMOPHILUS
Chains: 1
Atoms: 5,038
Mol. weight: 77.3 kDa
Ligands: GNP, MG
Released: 10 Aug 2005

Explore 2BV3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BV3 contains 25 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-19	8	1
α-helix	25-36	12
β-strand	69-74	6	1
β-strand	77-82	6	1
α-helix	83	1
α-helix	94-100	7
β-strand	103-109	7	1
α-helix	116-126	11
β-strand	132-137	6	1
α-helix	146-155	10
β-strand	161-163	3	1
β-strand	165-168	4	2
α-helix	171-173	3
β-strand	176-179	4	2
β-strand	184-188	5	2
β-strand	196-199	4	2
α-helix	200-202	3
α-helix	203-205	3
α-helix	206-221	16
α-helix	225-233	9
α-helix	235-238	4
α-helix	239-251	13
β-strand	256-260	5	1
β-strand	262	1	3
β-strand	267	1	3
α-helix	269-279	11
α-helix	287-289	3
β-strand	290-292	3	4
β-strand	298-300	3	4
β-strand	310-319	10	5
β-strand	323-332	10	5
β-strand	334-336	3	6
β-strand	339-343	5	5
β-strand	348-352	5	5
β-strand	354-358	5	5
β-strand	363-366	4	5
β-strand	368-370	3	6
β-strand	374-378	5	5
β-strand	388-391	4	5
β-strand	398	1	4
β-strand	409-410	2	7
β-strand	412	1	8
β-strand	439-442	4	8
β-strand	449-452	4	8
β-strand	453	1	7
α-helix	456-459	4
β-strand	480-481	2	7
β-strand	484-486	3	9
β-strand	491-500	10	10
β-strand	505-516	12	10
β-strand	523-527	5	10
α-helix	536-538	3
α-helix	539-549	11
β-strand	560	1	9
β-strand	563-571	9	10
α-helix	579-596	18
β-strand	600-613	14	9
α-helix	614-616	3
α-helix	617-625	9
β-strand	630-637	8	9
β-strand	640-648	9	9
α-helix	649-651	3
α-helix	655-661	7
β-strand	668-678	11	9
α-helix	679-680	2
α-helix	681-686	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor G	A	protein	691	THERMUS THERMOPHILUS	P13551 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BV3_1 ELONGATION FACTOR G (chains A)
MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE
RGITITAAVTTCFWKDHRINIIDAPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET
VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV
LRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEE
ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE
IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA
NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD
QEKLSQALARLAEESPTFSVSTHPETGSTIISGMGELSLEIIVDRLKREFKVDANVGKPQ
VAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP
AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPV
ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR
SKTQGRGSFVMFFDHYQEVPKQVQEKLIKGQ

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1

Primary citation

Crystal Structure of a Mutant Elongation Factor G Trapped with a GTP Analogue. Hansson, S., Singh, R., Gudkov, A.T. et al. FEBS Lett (2005) 579:4492. DOI 10.1016/J.FEBSLET.2005.07.016 · PubMed

Other PDB entries of the same protein (UniProt P13551 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BM0 2.4 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant T84A
2BM1 2.6 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant G16V
1FNM 2.8 Å, Structure of thermus thermophilus ef-G H573A
2J7K 2.9 Å, Crystal structure of the T84A mutant EF-G:GDPCP complex
4M1K 2.95 Å, Crystal structure of elongation factor G (EFG)
4MYU 3.0 Å, Crystal structure of elongation factor G mutant(EFG)
4MYT 3.5 Å, Crystal structure of elongation factor G (EFG)
1KTV 3.8 Å, Crystal Structure of Elongation Factor G Dimer Without Nucleotide
1PN6 10.8 Å, Domain-wise fitting of the crystal structure of T.thermophilus EF-G into the low…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1JQM 18.0 Å, Fitting of L11 protein and elongation factor G (EF-G) in the cryo-em map of e. coli 70S…
1JQS 18.0 Å, Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of…

Browse structure collections

About this viewer

MolViewer shows 2BV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.