2BWF: UBL domain of Dsk2 from S. cerevisiae

Crystal structure of the UBL domain of Dsk2 from S. cerevisiae. Determined by X-ray diffraction at 1.15 Å resolution. Released 25 Jan 2006.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 1,375
Mol. weight: 17.36 kDa
Released: 25 Jan 2006

Explore 2BWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BWF contains 8 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	0-2	3	1
β-strand	3-9	7	2
β-strand	12-18	7	2
β-strand	23	1	3
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	2
β-strand	49-50	2	2
α-helix	51-52	2
β-strand	56	1	3
α-helix	58-60	3
β-strand	67-72	6	2

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
β-strand	12-18	7	1
β-strand	23	1	4
α-helix	24-35	12
α-helix	39-41	3
β-strand	43-46	4	1
β-strand	49-50	2	1
α-helix	51-52	2
β-strand	56	1	4
α-helix	58-60	3
β-strand	67-73	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein DSK2	A, B	protein	77	SACCHAROMYCES CEREVISIAE	P48510 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2BWF_1 UBIQUITIN-LIKE PROTEIN DSK2 (chains A, B)
LDMSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVE
SYHIQDGHSVHLVKSQP

Primary citation

Structures of the Dsk2 Ubl and Uba Domains and Their Complex. Lowe, E.D., Hasan, N., Trempe, J.-F. et al. Acta Crystallogr D Biol Crystallogr (2006) 62:177. DOI 10.1107/S0907444905037777 · PubMed

Other PDB entries of the same protein (UniProt P48510 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UN2 1.51 Å, Crystal structure of the UBA domain of Dsk2 in complex with Ubiquitin
2BWB 2.3 Å, Crystal structure of the UBA domain of Dsk2 from S. cerevisiae
3M63 2.4 Å, Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Dsk2
2BWE 3.1 Å, The crystal structure of the complex between the UBA and UBL domains of Dsk2
1WR1 The complex structure of Dsk2p UBA with ubiquitin

Browse structure collections

About this viewer

MolViewer shows 2BWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.