Crystal Structure of the RIM2 C2A-domain at 1.4 angstrom Resolution. Determined by X-ray diffraction at 1.41 Å resolution. Released 20 Oct 2005.
Explore 2BWQ in 3D Show helices and sheets RCSB PDB PDBe
2BWQ contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 730-738 | 9 | 1 |
| β-strand | 743-752 | 10 | 1 |
| α-helix | 754-757 | 4 | |
| β-strand | 763 | 1 | 2 |
| β-strand | 765-772 | 8 | 3 |
| α-helix | 777-779 | 3 | |
| β-strand | 780-782 | 3 | 3 |
| α-helix | 783-786 | 4 | |
| β-strand | 789 | 1 | 2 |
| β-strand | 793-800 | 8 | 1 |
| α-helix | 805-810 | 6 | |
| β-strand | 812-819 | 8 | 3 |
| β-strand | 829-837 | 9 | 3 |
| α-helix | 838-840 | 3 | |
| β-strand | 847-851 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Regulating synaptic membrane exocytosis protein 2 | A | protein | 129 | RATTUS NORVEGICUS | Q9JIS1 (AlphaFold model) |
>2BWQ_1 REGULATING SYNAPTIC MEMBRANE EXOCYTOSIS PROTEIN 2 (chains A) QFLSGQLSIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNKRRTK TVKKTLEPKWNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLD DEPHWYKLQ
Crystal Structure of the Rim2 C(2)A-Domain at 1.4 A Resolution. Dai, H., Tomchick, D.R., Garcia, J. et al. Biochemistry (2005) 44:13533. DOI 10.1021/BI0513608 · PubMed
Other PDB entries of the same protein (UniProt Q9JIS1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BWQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.