Crystal Structure of the human Retinitis Pigmentosa protein 2 (RP2). Determined by X-ray diffraction at 2.1 Å resolution. Released 18 Jan 2006.
Explore 2BX6 in 3D Show helices and sheets RCSB PDB PDBe
2BX6 contains 12 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37-40 | 4 | |
| β-strand | 41-43 | 3 | 1 |
| β-strand | 46 | 1 | 1 |
| β-strand | 49-52 | 4 | 1 |
| β-strand | 62-65 | 4 | 1 |
| β-strand | 68 | 1 | 1 |
| β-strand | 71-74 | 4 | 1 |
| β-strand | 78 | 1 | 1 |
| β-strand | 81-84 | 4 | 1 |
| β-strand | 87 | 1 | 1 |
| β-strand | 90-103 | 14 | 1 |
| β-strand | 106-120 | 15 | 1 |
| β-strand | 123-131 | 9 | 1 |
| β-strand | 136-138 | 3 | 1 |
| β-strand | 141-147 | 7 | 1 |
| β-strand | 151 | 1 | 2 |
| α-helix | 155-161 | 7 | |
| β-strand | 175-176 | 2 | 1 |
| β-strand | 186-188 | 3 | 1 |
| α-helix | 189-190 | 2 | |
| α-helix | 195-197 | 3 | |
| α-helix | 200-202 | 3 | |
| α-helix | 205-208 | 4 | |
| β-strand | 213 | 1 | 2 |
| β-strand | 235-240 | 6 | 3 |
| α-helix | 246-259 | 14 | |
| β-strand | 263-270 | 8 | 3 |
| α-helix | 274-281 | 8 | |
| α-helix | 282-287 | 6 | |
| α-helix | 289-291 | 3 | |
| β-strand | 297-303 | 7 | 3 |
| α-helix | 307-318 | 12 | |
| β-strand | 324-326 | 3 | 3 |
| α-helix | 330-346 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| XRP2 protein | A | protein | 350 | HOMO SAPIENS | O75695 (AlphaFold model) |
>2BX6_1 XRP2 PROTEIN (chains A) MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQ QFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVR DCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPV SGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVL FAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIAL EFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Crystal Structure of the Human Retinitis Pigmentosa 2 Protein and its Interaction with Arl3. Kuhnel, K., Veltel, S., Schlichting, I. et al. Structure (2006) 14:367. DOI 10.1016/J.STR.2005.11.008 · PubMed
Other PDB entries of the same protein (UniProt O75695 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2BX6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.