2C7A: Progesterone receptor-DNA complex

Structure of the progesterone receptor-DNA complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 30 Aug 2006.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,045
Mol. weight: 28.61 kDa
Ligands: ZN
Released: 30 Aug 2006

Explore 2C7A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C7A contains 7 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	564-565	2
β-strand	566	1	1
α-helix	567	1
β-strand	573	1	1
β-strand	576-578	3	2
β-strand	581-583	3	2
α-helix	585-596	12
α-helix	620-630	11

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	566	1	3
β-strand	573	1	3
α-helix	574	1
β-strand	576-578	3	4
β-strand	581-583	3	4
α-helix	585-596	12
α-helix	620-630	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Progesterone receptor	A, B	protein	78	HOMO SAPIENS	P06401 (AlphaFold model)
5'-d(cpcpapgpapapcpapgptp tptpgptptpcptpg)-3'	C	DNA	18	HOMO SAPIENS
5'-d(cpcpapgpapapcpapapap cptpgptptpcptpg)-3'	D	DNA	18	HOMO SAPIENS

Sequence of entity 1 (A, B), FASTA

>2C7A_1 PROGESTERONE RECEPTOR (chains A, B)
PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPAC
RLRKCCQAGMVLGGRKFK

Sequence of entity 2 (C), FASTA

>2C7A_2 5'-D(*CP*CP*AP*GP*AP*AP*CP*AP*GP*TP *TP*TP*GP*TP*TP*CP*TP*G)-3' (chains C)
CCAGAACAGTTTGTTCTG

Sequence of entity 3 (D), FASTA

>2C7A_3 5'-D(*CP*CP*AP*GP*AP*AP*CP*AP*AP*AP *CP*TP*GP*TP*TP*CP*TP*G)-3' (chains D)
CCAGAACAAACTGTTCTG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structure of the Progesterone Receptor-Deoxyribonucleic Acid Complex: Novel Interactions Required for Binding to Half-Site Response Elements. Roemer, S.C., Donham, D.C., Sherman, L. et al. Mol Endocrinol (2006) 20:3042. DOI 10.1210/ME.2005-0511 · PubMed

Other PDB entries of the same protein (UniProt P06401 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SQN 1.45 Å, Progesterone Receptor Ligand Binding Domain with bound Norethindrone
1SR7 1.46 Å, Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate
3ZR7 1.65 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
1A28 1.8 Å, Hormone-bound human progesterone receptor ligand-binding domain
2W8Y 1.8 Å, RU486 bound to the progesterone receptor in a destabilized agonistic conformation
3ZRB 1.8 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
3G8O 1.9 Å, Progesterone Receptor with bound Pyrrolidine 1
3ZRA 1.9 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
4APU 1.9 Å, PR X-Ray structures in agonist conformations reveal two different mechanisms for partial…
1ZUC 2.0 Å, Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist…
2OVH 2.0 Å, Progesterone Receptor with Bound Asoprisnil and a Peptide from the Co-Repressor SMRT
3KBA 2.0 Å, Progesterone receptor bound to sulfonamide pyrrolidine partial agonist

Browse structure collections

About this viewer

MolViewer shows 2C7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.