2C7W: Vascular endothelial growth factor B precursor

Name: PDB 2C7W: Crystal Structure of human vascular endothelial growth factor-B: Identification of amino acids important for angiogeninc activity
Published: 2007-01-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: growth factor

Crystal Structure of human vascular endothelial growth factor-B: Identification of amino acids important for angiogeninc activity. Determined by X-ray diffraction at 2.48 Å resolution. Released 30 Jan 2007.

Method: X-ray diffraction
Resolution: 2.48 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,474
Mol. weight: 22.43 kDa
Released: 30 Jan 2007

Explore 2C7W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2C7W contains 2 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	1
α-helix	17-24	8
β-strand	25	1	2
β-strand	27-34	8	3
β-strand	46-48	3	4
β-strand	51-58	8	3
β-strand	60	1	2
β-strand	67-84	18	4
β-strand	87-104	18	4

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-15	2	4
α-helix	17-24	8
β-strand	25	1	5
β-strand	27-34	8	6
β-strand	47-48	2	1
β-strand	51-58	8	6
β-strand	60	1	5
β-strand	66-84	19	1
β-strand	87-105	19	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vascular endothelial growth factor B precursor	A, B	protein	99	HOMO SAPIENS	P49765 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2C7W_1 VASCULAR ENDOTHELIAL GROWTH FACTOR B PRECURSOR (chains A, B)
HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECV
PTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK

Primary citation

Crystal Structure of Human Vascular Endothelial Growth Factor-B: Identification of Amino Acids Important for Receptor Binding. Iyer, S., Scotney, P.D., Nash, A.D. et al. J Mol Biol (2006) 359:76. DOI 10.1016/J.JMB.2006.03.002 · PubMed

Other PDB entries of the same protein (UniProt P49765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TKK 1.06 Å, Neuropilin 1-b1 domain in a complex with the C-terminal VEGFB186 peptide
2XAC 2.71 Å, Structural Insights into the Binding of VEGF-B by VEGFR-1D2: Recognition and Specificity
2VWE 3.4 Å, Crystal Structure of Vascular Endothelial Growth Factor-B in Complex with a Neutralizing…

Browse structure collections

About this viewer

MolViewer shows 2C7W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.