2CA6: Ran gtpase-activating protein 1

MIRAS structure determination from hemihedrally twinned crystals. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Jan 2006.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: SCHIZOSACCHAROMYCES POMBE
Chains: 2
Atoms: 5,673
Mol. weight: 86.93 kDa
Released: 11 Jan 2006

Explore 2CA6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CA6 contains 37 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	12-13	2	2
α-helix	19-22	4
α-helix	26-30	5
β-strand	36-38	3	1
β-strand	43-44	2	2
α-helix	46-54	9
β-strand	64-66	3	1
α-helix	76-78	3
α-helix	80-90	11
β-strand	98-100	3	1
α-helix	111-120	10
β-strand	126-128	3	1
α-helix	135-156	22
α-helix	158-161	4
β-strand	163-165	3	1
α-helix	173-175	3
α-helix	176-185	10
β-strand	191-193	3	1
α-helix	201-209	9
α-helix	212-214	3
β-strand	220-222	3	1
α-helix	229-239	11
α-helix	240-242	3
β-strand	248-250	3	1
α-helix	258-269	12
β-strand	278-280	3	1
β-strand	287	1	3
α-helix	288-301	14
β-strand	307-309	3	1
β-strand	314	1	3
α-helix	320-332	13
β-strand	336-337	2	1
α-helix	338-339	2

Chain B: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	4
β-strand	12-13	2	5
α-helix	20-22	3
β-strand	36-38	3	4
β-strand	43-44	2	5
α-helix	46-58	13
β-strand	64-66	3	4
β-strand	71	1	5
α-helix	76-78	3
α-helix	80-90	11
β-strand	98-100	3	4
α-helix	108-110	3
α-helix	111-118	8
β-strand	126-128	3	4
α-helix	135-156	22
α-helix	158-161	4
β-strand	163-165	3	4
α-helix	173-175	3
α-helix	176-185	10
β-strand	191-193	3	4
α-helix	201-206	6
α-helix	207-211	5
α-helix	212-214	3
β-strand	220-222	3	4
α-helix	229-239	11
α-helix	240-242	3
β-strand	248-250	3	4
α-helix	258-268	11
β-strand	278-280	3	4
α-helix	288-301	14
β-strand	307-309	3	4
α-helix	321-332	12
β-strand	336-337	2	4
α-helix	338-339	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ran gtpase-activating protein 1	A, B	protein	386	SCHIZOSACCHAROMYCES POMBE	P41391 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2CA6_1 RAN GTPASE-ACTIVATING PROTEIN 1 (chains A, B)
MARFSIEGKSLKLDAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAARWLSENIASKK
DLEIAEFSDIFTGRVKDEIPEALRLLLQALLKCPKLHTVRLSDNAFGPTAQEPLIDFLSK
HTPLEHLYLHNNGLGPQAGAKIARALQELAVNKKAKNAPPLRSIICGRNRLENGSMKEWA
KTFQSHRLLHTVKMVQNGIRPEGIEHLLLEGLAYCQELKVLDLQDNTFTHLGSSALAIAL
KSWPNLRELGLNDCLLSARGAAAVVDAFSKLENIGLQTLRLQYNEIELDAVRTLKTVIDE
KMPDLLFLELNGNRFSEEDDVVDEIREVFSTRGRGELDELDDMEELTDEEEEDEEEEAES
QSPEPETSEEEKEDKELADELSKAHI

Primary citation

Detecting and Overcoming Hemihedral Twinning During the Mir Structure Determination of RNA1P. Hillig, R.C., Renault, L. Acta Crystallogr D Biol Crystallogr (2006) 62:750. DOI 10.1107/S0907444906016222 · PubMed

Other PDB entries of the same protein (UniProt P41391 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YRG 2.66 Å, The crystal structure of RNA1P: a new fold for a gtpase-activating protein
1K5D 2.7 Å, Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex
1K5G 3.1 Å, Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex

Browse structure collections

About this viewer

MolViewer shows 2CA6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.