2CLT: Interstitial collagenase

Crystal structure of the active form (full-length) of human fibroblast collagenase. Determined by X-ray diffraction at 2.67 Å resolution. Released 9 Aug 2006.

Method: X-ray diffraction
Resolution: 2.67 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 6,007
Mol. weight: 85.04 kDa
Ligands: ZN, CA
Released: 9 Aug 2006

Explore 2CLT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CLT contains 24 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	83	1	1
α-helix	84	1
β-strand	94-99	6	2
α-helix	108-123	16
β-strand	129-132	4	2
β-strand	140-145	6	2
β-strand	163-165	3	2
α-helix	166-167	2
β-strand	176-179	4	2
β-strand	185	1	3
β-strand	192	1	3
α-helix	193-205	13
β-strand	207	1	1
α-helix	231-241	11
α-helix	253-256	4
β-strand	267-271	5	4
β-strand	274-279	6	4
β-strand	282-286	5	4
β-strand	294-297	4	4
α-helix	298-300	3
α-helix	306	1
β-strand	311-315	5	5
β-strand	320-325	6	5
β-strand	328-333	6	5
β-strand	336-337	2	5
α-helix	338	1
β-strand	344	1	5
α-helix	345-349	5
β-strand	360-363	4	6
β-strand	369-374	6	6
β-strand	377-382	6	6
α-helix	383-385	3
β-strand	387-388	2	6
β-strand	394-395	2	6
α-helix	396-399	4
β-strand	409-413	5	7
β-strand	416-421	6	7
β-strand	424-429	6	7
β-strand	434-440	7	7

Chain B: 12 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	83	1	8
α-helix	84	1
β-strand	94-99	6	9
α-helix	108-123	16
β-strand	129-132	4	9
β-strand	140-145	6	9
β-strand	163-165	3	9
α-helix	166-167	2
β-strand	176-179	4	9
β-strand	185	1	10
β-strand	192	1	10
α-helix	193-204	12
β-strand	207	1	8
α-helix	231-241	11
α-helix	253-256	4
β-strand	267-271	5	11
β-strand	274-279	6	11
β-strand	282-286	5	11
β-strand	294-297	4	11
α-helix	298-301	4
α-helix	305-306	2
β-strand	311-315	5	12
α-helix	316-318	3
β-strand	320-325	6	12
β-strand	328-333	6	12
β-strand	336-337	2	12
β-strand	343-344	2	12
α-helix	345-348	4
β-strand	360-363	4	13
β-strand	369-374	6	13
β-strand	377-382	6	13
β-strand	387-388	2	13
β-strand	394-395	2	13
α-helix	396-399	4
β-strand	409-412	4	14
β-strand	417-421	5	14
β-strand	424-428	5	14
β-strand	437-440	4	14
α-helix	441-444	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interstitial collagenase	A, B	protein	367	HOMO SAPIENS	P03956 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2CLT_1 INTERSTITIAL COLLAGENASE (chains A, B)
FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADI
MISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHA
LGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACD
SKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDE
VRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWR
YDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQK
ANSWFNC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4
CA	Calcium ion	Ca	8

Primary citation

Crystal Structure of an Active Form of Human Mmp-1. Iyer, S., Visse, R., Nagase, H. et al. J Mol Biol (2006) 362:78. DOI 10.1016/J.JMB.2006.06.079 · PubMed

Other PDB entries of the same protein (UniProt P03956 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HFC 1.5 Å, 1.56 Å structure of mature truncated human fibroblast collagenase
1CGE 1.9 Å, Crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
966C 1.9 Å, Crystal structure of fibroblast collagenase-1 complexed to a diphenyl-ether sulphone…
1CGF 2.1 Å, Crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
1SU3 2.2 Å, X-ray structure of human proMMP-1: New insights into collagenase action
2TCL 2.2 Å, Structure of the catalytic domain of human fibroblast collagenase complexed with an…
3SHI 2.2 Å, Crystal structure of human MMP1 catalytic domain at 2.2 A resolution
1CGL 2.4 Å, Structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor
2J0T 2.54 Å, Crystal Structure of the Catalytic Domain of MMP-1 in Complex with the Inhibitory Domain…
4AUO 3.0 Å, Crystal structure of MMP-1(E200A) in complex with a triple-helical collagen peptide
1AYK Inhibitor-free catalytic fragment of human fibroblast collagenase, NMR, 30 structures
2AYK Inhibitor-free catalytic fragment of human fibroblast collagenase, NMR, minimized…

Browse structure collections

About this viewer

MolViewer shows 2CLT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.