2CLV: MHC Class I Natural Mutant H-2Kbm8 Heavy Chain

MHC Class I Natural Mutant H-2Kbm8 Heavy Chain Complexed With beta-2 Microglobulin and pBM8 peptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Jun 2006.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: MUS MUSCULUS
Chains: 6
Atoms: 6,950
Mol. weight: 89.64 kDa
Released: 14 Jun 2006

Explore 2CLV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CLV contains 24 α-helices and 58 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-150	13
α-helix	152-158	7
α-helix	159-163	5
α-helix	164-179	16
α-helix	184-185	2
β-strand	186-193	8	2
β-strand	198-208	11	2
β-strand	214-219	6	3
β-strand	222-223	2	3
β-strand	229-230	2	2
β-strand	234-235	2	2
β-strand	241-250	10	2
α-helix	254-256	3
β-strand	257-262	6	3
β-strand	270-272	3	3

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	4
α-helix	4-5	2
β-strand	6-11	6	5
β-strand	21-30	10	5
β-strand	31	1	4
β-strand	36-41	6	6
β-strand	44-45	2	6
β-strand	50-51	2	5
α-helix	52-54	3
β-strand	55-56	2	5
β-strand	62-70	9	5
β-strand	78-83	6	6
β-strand	91-94	4	6

Chain H: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	7
α-helix	20	1
β-strand	21-28	8	7
β-strand	31-37	7	7
β-strand	46-47	2	7
α-helix	50-52	3
α-helix	57-85	29
β-strand	94-103	10	7
β-strand	109-118	10	7
β-strand	121-126	6	7
β-strand	133-135	3	7
α-helix	138-150	13
α-helix	152-158	7
α-helix	159-163	5
α-helix	164-179	16
β-strand	183	1	8
β-strand	186-193	8	9
β-strand	198-208	11	9
β-strand	209	1	8
β-strand	214-219	6	10
β-strand	222-223	2	10
β-strand	228-230	3	9
α-helix	231-233	3
β-strand	234-235	2	9
β-strand	241-250	10	9
α-helix	254-256	3
β-strand	257-262	6	10
β-strand	270-272	3	10

Chain M: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3

Chain P: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2	1
β-strand	3	1	11
α-helix	4-5	2
β-strand	6-11	6	12
β-strand	21-30	10	12
β-strand	31	1	11
β-strand	36-41	6	13
β-strand	44-45	2	13
β-strand	50-51	2	12
α-helix	52-54	3
β-strand	55-56	2	12
β-strand	62-70	9	12
β-strand	78-83	6	13
β-strand	91-94	4	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class I histocompatibility antigen, K-B alpha chain	A, H	protein	279	MUS MUSCULUS	P01901 (AlphaFold model)
Beta-2 microglobulin	B, P	protein	99	MUS MUSCULUS	P01887 (AlphaFold model)
RBM5 protein	C, M	protein	8	MUS MUSCULUS	Q91YE7 (AlphaFold model)

Sequence of entity 1 (A, H), FASTA

>2CLV_1 H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN (chains A, H)
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYW
ERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDG
CDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLL
RTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPS

Sequence of entity 2 (B, P), FASTA

>2CLV_2 BETA-2 MICROGLOBULIN (chains B, P)
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW
SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Sequence of entity 3 (C, M), FASTA

>2CLV_3 RBM5 PROTEIN (chains C, M)
SQYYYNSL

Primary citation

Distinct orientation of the alloreactive monoclonal CD8 T cell activation program by three different peptide/MHC complexes. Auphan-Anezin, N., Mazza, C., Guimezanes, A. et al. Eur J Immunol (2006) 36:1856-1866. DOI 10.1002/eji.200635895 · PubMed

Other PDB entries of the same protein (UniProt P01901 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
1G7P 1.5 Å, Crystal structure of MHC class I H-2KB heavy chain complexed with beta-2 microglobulin…
1KPU 1.5 Å, High resolution crystal structure of the MHC class I complex H-2Kb/VSV8
1G7Q 1.6 Å, Crystal structure of MHC class I H-2KB heavy chain complexed with beta-2 microglobulin…
3TID 1.65 Å, Crystal structure of the LCMV derived peptide GP34 in complex with the murine mhc class…
1FZK 1.7 Å, MHC class I natural mutant H-2KBM1 heavy chain complexed with beta-2 microglobulin and…
1KPV 1.71 Å, High resolution crystal structure of the MHC class I complex H-2Kb/SEV9
1LEG 1.75 Å, Crystal Structure of H-2Kb bound to the dEV8 peptide
6GB6 1.78 Å, Structure of H-2Kb with dipeptide GL
1FZM 1.8 Å, MHC class I natural mutant H-2KBM8 heavy chain complexed with beta-2 microglobulin and…
1FZO 1.8 Å, MHC class I natural mutant H-2KBM8 heavy chain complexed with beta-2 microglobulin and…
1T0N 1.8 Å, Conformational switch in polymorphic H-2K molecules containing an HSV peptide

Browse structure collections

About this viewer

MolViewer shows 2CLV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.