2CNX: WDR5 and Histone H3 Lysine 4 dimethyl complex

WDR5 and Histone H3 Lysine 4 dimethyl complex at 2.1 angstrom. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 Jul 2006.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,605
Mol. weight: 35.22 kDa
Released: 3 Jul 2006

Explore 2CNX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CNX contains 0 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	36-41	6	1
β-strand	48-53	6	2
β-strand	59-64	6	2
β-strand	68-73	6	2
β-strand	79-84	6	2
β-strand	90-95	6	3
β-strand	101-106	6	3
β-strand	110-115	6	3
β-strand	120-126	7	3
β-strand	132-137	6	4
β-strand	143-148	6	4
β-strand	153-157	5	4
β-strand	163-167	5	4
β-strand	174-179	6	5
β-strand	185-190	6	5
β-strand	195-199	5	5
β-strand	205-210	6	5
β-strand	217-222	6	6
β-strand	228-233	6	6
β-strand	237-242	6	6
β-strand	247-252	6	6
β-strand	264-267	4	7
β-strand	273-276	4	7
β-strand	283-287	5	7
β-strand	293-297	5	7
β-strand	304-309	6	1
β-strand	315-320	6	1
β-strand	327-331	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Wd-repeat protein 5	A	protein	315	HOMO SAPIENS	P61964 (AlphaFold model)
Histone H3 dimethyl-lysine 4	P	protein	5	HOMO SAPIENS	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CNX_1 WD-REPEAT PROTEIN 5 (chains A)
SSSATQSKPTPVKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKF
EKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNP
QSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD
TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEK
YCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASA
ALENDKTIKLWKSDC

Sequence of entity 2 (P), FASTA

>2CNX_2 HISTONE H3 DIMETHYL-LYSINE 4 (chains P)
ARTKQ

Primary citation

Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex. Ruthenburg, A.J., Wang, W., Graybosch, D.M. et al. Nat Struct Mol Biol (2006) 13:704. DOI 10.1038/NSMB1119 · PubMed

Other PDB entries of the same protein (UniProt P61964 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E1Z 1.1 Å, Displacement of WDR5 from chromatin by a pharmacological WIN site inhibitor with…
6U6W 1.2 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
6E1Y 1.22 Å, Discovery of Potent 2-Aryl-6,7-Dihydro-5HPyrrolo[ 1,2-a]imidazoles as WDR5 WIN-site…
6UHZ 1.26 Å, WDR5 in complex with Myc site fragment inhibitor
6UHY 1.26 Å, WDR5 in complex with Myc site fragment inhibitor
7BED 1.26 Å, X-ray structure of WDR5 bound to the WDR5 win motif peptide
6U8B 1.26 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
24XP 1.3 Å, Crystal structure of WDR5 F133A variant in complex with MBD3C
4ERY 1.3 Å, X-ray structure of WDR5-MLL3 Win motif peptide binary complex
8G3E 1.33 Å, Crystal structure of human WDR5 in complex with (1M)-N-[(3,5-difluoro[1,1'-biphenyl]-4-yl…
3EMH 1.37 Å, Structural basis of WDR5-MLL interaction
3UVK 1.4 Å, Crystal structure of WDR5 in complex with the WDR5-interacting motif of MLL2

Browse structure collections

About this viewer

MolViewer shows 2CNX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.