2CR4: SH2 domain of human SH3BP2 protein

Solution structure of the SH2 domain of human SH3BP2 protein. Determined by solution NMR. Released 20 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 989
Mol. weight: 14.05 kDa
Released: 20 Nov 2005

Explore 2CR4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CR4 contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	1
α-helix	26-36	11
α-helix	42-43	2
β-strand	47-51	5	1
β-strand	58-62	5	1
β-strand	63-64	2	2
β-strand	69-70	2	2
β-strand	73-74	2	1
β-strand	76-78	3	3
β-strand	81-83	3	3
β-strand	89-90	2	3
α-helix	93-100	8
β-strand	116	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 domain-binding protein 2	A	protein	126	Homo sapiens	P78314 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CR4_1 SH3 domain-binding protein 2 (chains A)
GSSGSSGEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVL
VVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYT
SGPSSG

Primary citation

Solution structure of the SH2 domain of human SH3BP2 protein. Hatta, R., Tomizawa, T., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt P78314 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TWR 1.55 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human 3BP2

Browse structure collections

About this viewer

MolViewer shows 2CR4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.