2CSK: PX domain from human SNX12

Solution structure of PX domain from human SNX12. Determined by solution NMR. Released 22 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,176
Mol. weight: 16.71 kDa
Released: 22 Nov 2005

Explore 2CSK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CSK contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	12-21	10	1
β-strand	28-36	9	1
β-strand	46-51	6	1
α-helix	53-63	11
α-helix	71-74	4
α-helix	94-113	20
α-helix	115-119	5
α-helix	121-126	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin 12	A	protein	146	Homo sapiens	Q9UMY4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CSK_1 Sorting nexin 12 (chains A)
GSSGSSGSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLK
NELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNE
RCLHMFLQEEAIDRNYVPGKSGPSSG

Primary citation

Solution structure of PX domain from human SNX12. Suetake, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt Q9UMY4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Q8M 3.13 Å, VPS35-VPS26-SNX12 Complex

Browse structure collections

About this viewer

MolViewer shows 2CSK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.