Solution structure of the FHA domain of human ubiquitin ligase protein RNF8. Determined by solution NMR. Released 23 Nov 2005.
Explore 2CSW in 3D Show helices and sheets RCSB PDB PDBe
2CSW contains 2 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-20 | 5 | 1 |
| β-strand | 29 | 1 | 2 |
| β-strand | 30-31 | 2 | 1 |
| β-strand | 38-41 | 4 | 3 |
| β-strand | 44 | 1 | 4 |
| β-strand | 46 | 1 | 4 |
| β-strand | 48-49 | 2 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 64-68 | 5 | 3 |
| β-strand | 74-77 | 4 | 3 |
| β-strand | 78 | 1 | 5 |
| β-strand | 85-87 | 3 | 6 |
| β-strand | 91 | 1 | 6 |
| β-strand | 94 | 1 | 5 |
| β-strand | 98-99 | 2 | 3 |
| β-strand | 106-108 | 3 | 6 |
| β-strand | 124-128 | 5 | 1 |
| α-helix | 129-132 | 4 | |
| β-strand | 136 | 1 | 2 |
| β-strand | 139 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin ligase protein RNF8 | A | protein | 145 | Homo sapiens | O76064 (AlphaFold model) |
>2CSW_1 Ubiquitin ligase protein RNF8 (chains A) GSSGSSGVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMIS RNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEY EYEVTEEDWETIYPCLSPKSGPSSG
Solution structure of the FHA domain of human ubiquitin ligase protein RNF8. Hayashi, F., Nagashima, T., Yokoyama, S. To be published.
Other PDB entries of the same protein (UniProt O76064 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2CSW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.