2CU1: PB1 domain of human protein kinase MEKK2b

Solution structure of the PB1 domain of human protein kinase MEKK2b. Determined by solution NMR. Released 24 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 795
Mol. weight: 11.35 kDa
Released: 24 Nov 2005

Explore 2CU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CU1 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	1
β-strand	18-25	8	1
α-helix	28	1
α-helix	30-41	12
β-strand	45-49	5	2
β-strand	56-57	2	2
α-helix	61-73	13
β-strand	80-81	2	1
β-strand	82-86	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase kinase kinase 2	A	protein	103	Homo sapiens	Q9Y2U5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CU1_1 Mitogen-activated protein kinase kinase kinase 2 (chains A)
GSSGSSGDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTT
QDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPSGPSSG

Primary citation

Solution structure of the PB1 domain of human protein kinase MEKK2b. Inoue, K., Nagashima, T., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y2U5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6LDW 1.6 Å, Structure of antibody C9 in complex with methylated peptide
5HQ8 1.72 Å, Co-crystal Structure of human SMYD3 with a MEKK2 peptide at 2.13A
2NPT 1.75 Å, Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox…
6LDY 1.77 Å, Structure antibody D6 in complex with methylated peptide
6LDX 1.8 Å, Structure antibody E6 in complex with methylated peptide
6LDV 1.9 Å, Structure antibody F9 in complex with methylated peptide
9P6A 2.4 Å, The catalytic domain of MEKK2 in complex with ponatinib
5EX0 2.7 Å, Crystal structure of human SMYD3 in complex with a MAP3K2 peptide

Browse structure collections

About this viewer

MolViewer shows 2CU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.