2CV1: Glutamyl-tRNA synthetase

Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu), ATP, and an analog of L-glutamate: a quaternary complex. Determined by X-ray diffraction at 2.41 Å resolution. Released 5 Sept 2006.

Method: X-ray diffraction
Resolution: 2.41 Å
Organism: Thermus thermophilus
Chains: 4
Atoms: 11,088
Mol. weight: 157.57 kDa
Ligands: GAU, ATP, MG
Released: 5 Sept 2006

Explore 2CV1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CV1 contains 60 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	14	1
β-strand	15	1	2
α-helix	16-31	16
β-strand	35-38	4	1
β-strand	40	1	3
α-helix	52-63	12
β-strand	69	1	1
β-strand	70	1	4
β-strand	74	1	4
β-strand	81	1	3
α-helix	82-84	3
α-helix	86-99	14
β-strand	102-105	4	5
α-helix	109-119	11
α-helix	125-128	4
α-helix	131-139	9
β-strand	145-148	4	5
β-strand	155-160	6	6
β-strand	164-169	6	6
α-helix	170-172	3
β-strand	177-179	3	5
α-helix	184	1
β-strand	185	1	5
α-helix	186	1
α-helix	187-197	11
β-strand	202-206	5	6
α-helix	207-212	6
α-helix	213-222	10
β-strand	229-233	5	6
α-helix	234-236	3
β-strand	237	1	7
β-strand	243	1	7
β-strand	252	1	2
α-helix	253-258	6
α-helix	263-271	9
β-strand	275	1	8
α-helix	286-292	7
α-helix	295-297	3
β-strand	298	1	8
β-strand	304	1	7
α-helix	307-320	14
α-helix	324-337	14
α-helix	345-355	11
α-helix	356-358	3
α-helix	364-368	5
α-helix	370-372	3
α-helix	381-403	23
α-helix	409-422	14
α-helix	428-439	12
α-helix	447-454	8
α-helix	456-467	12

Chain B: 30 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	9
α-helix	14	1
β-strand	15	1	10
α-helix	16-31	16
β-strand	35-38	4	9
β-strand	40	1	11
α-helix	52-62	11
β-strand	69	1	9
β-strand	70	1	12
β-strand	74	1	12
β-strand	81	1	11
α-helix	82-84	3
α-helix	86-98	13
β-strand	102-105	4	13
α-helix	109-118	10
α-helix	125-128	4
α-helix	131-139	9
β-strand	145-148	4	13
β-strand	155-160	6	14
β-strand	164-169	6	14
α-helix	170-172	3
β-strand	177-179	3	13
α-helix	184	1
β-strand	185	1	13
α-helix	186	1
α-helix	187-197	11
β-strand	202-206	5	14
α-helix	207-212	6
α-helix	213-223	11
β-strand	229-233	5	14
α-helix	234-236	3
β-strand	237	1	15
β-strand	243	1	15
β-strand	252	1	10
α-helix	253-258	6
α-helix	263-272	10
β-strand	275	1	16
α-helix	286-292	7
α-helix	295-297	3
β-strand	298	1	16
β-strand	304	1	15
α-helix	307-320	14
α-helix	324-337	14
α-helix	345-355	11
α-helix	356-358	3
α-helix	364-368	5
α-helix	370-372	3
α-helix	381-403	23
α-helix	409-422	14
α-helix	427-439	13
α-helix	447-453	7
α-helix	456-467	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
tRNA	C, D	RNA	75
glutamyl-tRNA synthetase	A, B	protein	468	Thermus thermophilus	P27000 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>2CV1_1 tRNA (chains C, D)
GGCCCCAUCGUCUAGCGGUUAGGACGCGGCCCUCUCAAGGCCGAAACGGGGGUUCGAUUC
CCCCUGGGGUCACCA

Sequence of entity 2 (A, B), FASTA

>2CV1_2 glutamyl-tRNA synthetase (chains A, B)
MVVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTDRARYVPGAEERILAAL
KWLGLSYDEGPDVGGPHGPYRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKG
GYDGRARNIPPEEAEERARRGEPHVIRLKVPRPGTTEVKDELRGVVVYDNQEIPDVVLLK
SDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEAPRFYHMPLLRNPD
KTKISKRKSHTSLDWYKAEGFLPEALRNYLCLMGFSMPDGREIFTLEEFIQAFTWERVSL
GGPVFDLEKLRWMNGKYIREVLSLEEVAERVKPFLREAGLSWESEAYLRRAVELMRPRFD
TLKEFPEKARYLFTEDYPVSEKAQRKLEEGLPLLKELYPRLRAQEEWTEAALEALLRGFA
AEKGVKLGQVAQPLRAALTGSLETPGLFEILALLGKERALRRLERALA

Ligands and cofactors

ID	Name	Formula	Copies
GAU	(4S)-4-amino-5-hydroxypentanoic acid	C5 H11 N O3	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	4

Primary citation

Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu), ATP, and an analog of L-glutamate: a quaternary complex. Sekine, S., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt P27000 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J09 1.8 Å, Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with ATP…
1N75 1.9 Å, Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with ATP.
2CUZ 1.98 Å, Glutamyl-tRNA synthetase from Thermus thermophilus in complex with L-glutamate
1N78 2.1 Å, Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with…
2DXI 2.2 Å, 2.2 A crystal structure of glutamyl-tRNA synthetase from Thermus thermophilus complexed…
1G59 2.4 Å, Glutamyl-tRNA synthetase complexed with trna(glu).
1N77 2.4 Å, Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with…
2CV0 2.4 Å, Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu) and…
1GLN 2.5 Å, Architectures of class-defining and specific domains of glutamyl-tRNA synthetase
2CV2 2.69 Å, Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu) and an…

Browse structure collections

About this viewer

MolViewer shows 2CV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.