2D9L: ArfGap domain of human RIP

Solution structure of the ArfGap domain of human RIP. Determined by solution NMR. Released 11 Dec 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,057
Mol. weight: 15.18 kDa
Ligands: ZN
Released: 11 Dec 2006

Explore 2D9L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D9L contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-14	7
β-strand	22	1	1
β-strand	29	1	1
β-strand	33-35	3	2
α-helix	44-52	9
β-strand	59-61	3	2
α-helix	69-76	8
α-helix	79-87	9
α-helix	104-115	12
α-helix	124-127	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin-like protein RIP	A	protein	134	Homo sapiens	P52594 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D9L_1 Nucleoporin-like protein RIP (chains A)
GSSGSSGLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVK
SISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRW
YVPPEQAKSGPSSG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution structure of the ArfGap domain of human RIP. Suetake, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt P52594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OLM 1.48 Å, ArfGap domain of HIV-1 Rev binding protein
2VX8 2.2 Å, Vamp7 longin domain Hrb peptide complex

Browse structure collections

About this viewer

MolViewer shows 2D9L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.