Solution Structure of the N-terminal CUE Domain in the Human Mitogen-activated Protein Kinase Kinase Kinase 7 Interacting Protein 2 (MAP3K7IP2). Determined by solution NMR. Released 20 Feb 2007.
Explore 2DAE in 3D Show helices and sheets RCSB PDB PDBe
2DAE contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-20 | 10 | |
| α-helix | 26-33 | 8 | |
| α-helix | 41-52 | 12 | |
| α-helix | 53-57 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| KIAA0733 protein | A | protein | 75 | Homo sapiens | Q9NYJ8 (AlphaFold model) |
>2DAE_1 KIAA0733 protein (chains A) GSSGSSGQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGD LNFSDDSGISGPSSG
Solution Structure of the N-terminal CUE Domain in the Human Mitogen-activated Protein Kinase Kinase Kinase 7 Interacting Protein 2 (MAP3K7IP2). Zhao, C., Kigawa, T., Sato, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q9NYJ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DAE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.