The solution structure of the thioredoxin domain of human Thioredoxin-related transmembrane protein 2. Determined by solution NMR. Released 30 Sept 2006.
Explore 2DJ0 in 3D Show helices and sheets RCSB PDB PDBe
2DJ0 contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-11 | 2 | 1 |
| α-helix | 16-23 | 8 | |
| β-strand | 29-33 | 5 | 1 |
| α-helix | 45-55 | 11 | |
| β-strand | 61-64 | 4 | 1 |
| α-helix | 71-76 | 6 | |
| β-strand | 90-94 | 5 | 1 |
| β-strand | 99-103 | 5 | 1 |
| α-helix | 105 | 1 | |
| β-strand | 106 | 1 | 2 |
| α-helix | 107 | 1 | |
| β-strand | 112 | 1 | 2 |
| α-helix | 119-122 | 4 | |
| α-helix | 123-127 | 5 | |
| α-helix | 128-131 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thioredoxin-related transmembrane protein 2 | A | protein | 137 | Homo sapiens | Q9Y320 (AlphaFold model) |
>2DJ0_1 Thioredoxin-related transmembrane protein 2 (chains A) GSSGSSGYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGL NFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEE NVIREFNLNELSGPSSG
The solution structure of the thioredoxin domain of human Thioredoxin-related transmembrane protein 2. Tochio, N., Koshiba, S., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q9Y320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.