Solution structure of RNA binding domain in Synaptojanin 1. Determined by solution NMR. Released 26 Oct 2006.
Explore 2DNR in 3D Show helices and sheets RCSB PDB PDBe
2DNR contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 894-900 | 7 | 1 |
| α-helix | 911-922 | 12 | |
| β-strand | 927-932 | 6 | 1 |
| β-strand | 937-941 | 5 | 1 |
| α-helix | 944-949 | 6 | |
| α-helix | 950-953 | 4 | |
| β-strand | 957-958 | 2 | 1 |
| β-strand | 961-967 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Synaptojanin-1 | A | protein | 91 | Homo sapiens | O43426 (AlphaFold model) |
>2DNR_1 Synaptojanin-1 (chains A) GSSGSSGGTVLVSIKSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGS SALNVLSLNGKELLNRTITIALKSPSGPSSG
Solution structure of RNA binding domain in Synaptojanin 1. Tsuda, K., Muto, Y., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt O43426 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DNR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.