2DO7: Winged helix-turn-helix motif of human CUL-4B

Solution structure of the winged helix-turn-helix motif of human CUL-4B. Determined by solution NMR. Released 17 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 809
Mol. weight: 11.57 kDa
Released: 17 Apr 2007

Explore 2DO7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DO7 contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	823-842	20
β-strand	845-847	3	1
α-helix	848-858	11
α-helix	865-877	13
β-strand	881-883	3	1
β-strand	890-893	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cullin-4B	A	protein	101	Homo sapiens	Q13620 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DO7_1 Cullin-4B (chains A)
GSSGSSGIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLK
FPVKPADLKKRIESLIDRDYMERDKENPNQYNYIASGPSSG

Primary citation

Solution structure of the winged helix-turn-helix motif of human CUL-4B. Suzuki, S., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q13620 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4A64 2.57 Å, Crystal structure of the N-terminal domain of human Cul4B at 2.57A resolution
8EI1 2.89 Å, Crystal structure of the N-terminal domain of CUL4B in complex with H316, a Helicon…
4A0C 3.8 Å, Structure of the CAND1-CUL4B-RBX1 complex
4A0L 7.4 Å, Structure of DDB1-DDB2-CUL4B-RBX1 bound to a 12 bp abasic site containing DNA-duplex

Browse structure collections

About this viewer

MolViewer shows 2DO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.