2DVW: Oncoprotein Gankyrin

Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Mar 2007.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 2,612
Mol. weight: 34.88 kDa
Released: 13 Mar 2007

Explore 2DVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DVW contains 19 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	9-16	8
α-helix	19-28	10
α-helix	30-34	5
α-helix	43-50	8
α-helix	53-62	10
α-helix	76-82	7
α-helix	86-94	9
α-helix	109-115	7
α-helix	119-127	9
α-helix	142-149	8
α-helix	152-160	9
α-helix	175-181	7
α-helix	185-193	9
α-helix	208-211	4
α-helix	214-229	16

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	338-348	11
β-strand	354	1	1
α-helix	361-364	4
α-helix	372-388	17
β-strand	394	1	1
α-helix	396-406	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
26S proteasome non-ATPase regulatory subunit 10	A	protein	231	Mus musculus	Q9Z2X2 (AlphaFold model)
26S protease regulatory subunit 6B	B	protein	83	Homo sapiens	P43686 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DVW_1 26S proteasome non-ATPase regulatory subunit 10 (chains A)
MEGCVSNIMICNLAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHE
IAVMLLEGGANPDAKDHYDATAMHRAAAKGNLKMVHILLFYKASTNIQDTEGNTPLHLAC
DEERVEEAKFLVTQGASIYIENKEEKTPLQVAKGGLGLILKRLAEGEEASM

Sequence of entity 2 (B), FASTA

>2DVW_2 26S protease regulatory subunit 6B (chains B)
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVL
AKDFEKAYKTVIKKDEQEHEFYK

Primary citation

Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome. Nakamura, Y., Nakano, K., Umehara, T. et al. Structure (2007) 15:179-189. DOI 10.1016/j.str.2006.11.015 · PubMed

Other PDB entries of the same protein (UniProt Q9Z2X2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AJI 2.05 Å, Structure of Gankyrin-S6ATPase photo-cross-linked site-specifically, and incoporated by…
2DWZ 2.4 Å, Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome

Browse structure collections

About this viewer

MolViewer shows 2DVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.