2E56: Human MD-2

Crystal structure of human MD-2. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Jun 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,397
Mol. weight: 17.71 kDa
Ligands: NAG, MYR
Released: 26 Jun 2007

Explore 2E56 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E56 contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	18-21	4
β-strand	22-26	5	1
β-strand	30-36	7	1
β-strand	45-49	5	2
α-helix	51-53	3
β-strand	57-65	9	2
β-strand	75-82	8	1
β-strand	85-86	2	1
α-helix	87-88	2
β-strand	90-93	4	1
α-helix	103-106	4
β-strand	113-121	9	2
β-strand	130-139	10	1
β-strand	144-155	12	1
α-helix	156	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lymphocyte antigen 96	A	protein	144	Homo sapiens	Q9Y6Y9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2E56_1 Lymphocyte antigen 96 (chains A)
EAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYF
NLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVE
AISGSPEEMLFCLEFVILHQPNSN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
MYR	Myristic acid	C14 H28 O2	3

Primary citation

Crystal structures of human MD-2 and its complex with antiendotoxic lipid IVa. Ohto, U., Fukase, K., Miyake, K. et al. Science (2007) 316:1632-1634. DOI 10.1126/science.1139111 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6Y9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2E59 2.21 Å, Crystal structure of human MD-2 in complex with lipid IVa
8WO1 2.24 Å, Cryo-EM Structure of Human TLR4/MD-2/DLAM5 Complex
4G8A 2.4 Å, Crystal structure of human TLR4 polymorphic variant D299G and T399I in complex with MD-2…
2Z65 2.7 Å, Crystal structure of the human TLR4 TV3 hybrid-MD-2-Eritoran complex
9J03 2.7 Å, Cyro-EM Structure of Human TLR4/MD-2/DLAM1 Complex
8WTA 2.9 Å, Cryo-EM Structure of Human TLR4/MD-2/DLAM3 Complex
3FXI 3.1 Å, Crystal structure of the human TLR4-human MD-2-E.coli LPS Ra complex
3ULA 3.6 Å, Crystal structure of the TV3 mutant F63W-MD-2-Eritoran complex

Browse structure collections

About this viewer

MolViewer shows 2E56 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.