2E7L: High-affinity mutant of the 2C TCR

Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9. Determined by X-ray diffraction at 2.5 Å resolution. Released 24 Apr 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 8
Atoms: 6,682
Mol. weight: 96.47 kDa
Released: 24 Apr 2007

Explore 2E7L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E7L contains 19 α-helices and 66 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	9-13	5	2
β-strand	18-20	3	1
β-strand	23-24	2	1
β-strand	32-37	6	2
β-strand	44-49	6	2
β-strand	55-57	3	1
β-strand	62-67	6	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	87-93	7	2
β-strand	104-106	3	2
β-strand	110-115	6	2

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	3
β-strand	9-13	5	4
β-strand	18-20	3	3
β-strand	23-24	2	3
β-strand	32-37	6	4
β-strand	44-49	6	4
β-strand	55-57	3	3
β-strand	62-67	6	3
β-strand	72-77	6	3
α-helix	82-84	3
β-strand	86-99	9	4
β-strand	103-106	4	4
β-strand	110-115	6	4

Chains C and D: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	5
β-strand	10-14	5	6
β-strand	19-21	3	7
β-strand	22-25	4	5
β-strand	31-37	7	6
β-strand	43-49	7	6
β-strand	56-57	2	6
β-strand	65-68	4	7
β-strand	74	1	5
β-strand	76-79	4	7
α-helix	84-86	3
β-strand	88-95	8	6
β-strand	107-108	2	6
β-strand	112-117	6	6

Chain E: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	11
α-helix	20	1
β-strand	21-28	8	11
β-strand	31-37	7	11
β-strand	46-47	2	11
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	11
β-strand	109-118	10	11
β-strand	121-126	6	11
β-strand	133-135	3	11
α-helix	138-149	12
α-helix	152-161	10
α-helix	163-174	12

Chain F: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	12
α-helix	20	1
β-strand	21-28	8	12
β-strand	31-37	7	12
β-strand	46-47	2	12
α-helix	50-52	3
α-helix	57-84	28
β-strand	94-103	10	12
β-strand	109-118	10	12
β-strand	121-126	6	12
β-strand	133-135	3	12
α-helix	138-149	12
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-171	7

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-8	6

Chain Q: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytotoxic Tcell receptor	A, B	protein	113	Mus musculus	A2NTU7 (AlphaFold model)
Beta-chain	C, D	protein	121	Mus musculus	A2NTY6 (AlphaFold model)
H-2 class I histocompatibility antigen, L-D alpha chain	E, F	protein	181	Mus musculus	P01897 (AlphaFold model)
Peptide (GLN)(LEU)(SER)(PRO)(PHE)(PRO)(PHE)(ASP)(LEU)	P, Q	protein	9

Sequence of entity 1 (A, B), FASTA

>2E7L_1 Cytotoxic Tcell receptor (chains A, B)
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGPQLLLKYYSGDPVVQGVN
GFEAEFSKSNSSFHLRKASVHRSDSAVYFCAVSHQGRYLTFGSGTKVIVLPYN

Sequence of entity 2 (C, D), FASTA

>2E7L_2 Beta-chain (chains C, D)
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDI
PDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLSSALEHHHHH
H

Sequence of entity 3 (E, F), FASTA

>2E7L_3 H-2 class I histocompatibility antigen, L-D alpha chain (chains E, F)
GPHSMRYFETAVSRRGLGEPRYISVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYW
ERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDG
CDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATLL
R

Sequence of entity 4 (P, Q), FASTA

>2E7L_4 Peptide (GLN)(LEU)(SER)(PRO)(PHE)(PRO)(PHE)(ASP)(LEU) (chains P, Q)
QLSPFPFDL

Primary citation

How a single T cell receptor recognizes both self and foreign MHC. Colf, L.A., Bankovich, A.J., Hanick, N.A. et al. Cell (2007) 129:135-146. DOI 10.1016/j.cell.2007.01.048 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2E7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.