Solution structure of the CH domain from human MICAL-2. Determined by solution NMR. Released 31 Jul 2007.
Explore 2E9K in 3D Show helices and sheets RCSB PDB PDBe
2E9K contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-22 | 11 | |
| α-helix | 35-37 | 3 | |
| α-helix | 41-50 | 10 | |
| α-helix | 62-64 | 3 | |
| α-helix | 65-75 | 11 | |
| α-helix | 76-80 | 5 | |
| α-helix | 88-93 | 6 | |
| α-helix | 99-113 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein MICAL-2 | A | protein | 121 | Homo sapiens | O94851 (AlphaFold model) |
>2E9K_1 Protein MICAL-2 (chains A) GSSGSSGDIRPSKLLTWCQQQTEGYQHVNVTDLTTSWRSGLALCAIIHRFRPELINFDSL NEDDAVENNQLAFDVAEREFGIPPVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRP V
Solution structure of the CH domain from human MICAL-2. Tomizawa, T., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt O94851 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2E9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.