2EC1: RanBD1 domain from human Nucleoporin 50 kDa

Solution structure of the RanBD1 domain from human Nucleoporin 50 kDa. Determined by solution NMR. Released 14 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 932
Mol. weight: 13.87 kDa
Released: 14 Aug 2007

Explore 2EC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EC1 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	16-25	10	1
β-strand	30-42	13	1
β-strand	48-54	7	1
β-strand	61	1	1
β-strand	65-66	2	1
β-strand	73-74	2	1
β-strand	80-85	6	1
β-strand	100-105	6	1
α-helix	109-124	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin 50 kDa	A	protein	125	Homo sapiens	Q9UKX7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EC1_1 Nucleoporin 50 kDa (chains A)
GSSGSSGEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGN
ILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILL
EKKDA

Primary citation

Solution structure of the RanBD1 domain from human Nucleoporin 50 kDa. Zhang, H.P., Kurosaki, C., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UKX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MO0 2.45 Å, Crystal Structure of Nucleoporin NUP50 Ran-Binding Domain in Complex with Ran-GPPNHP
3TJ3 2.7 Å, Structure of importin a5 bound to the N-terminus of Nup50

Browse structure collections

About this viewer

MolViewer shows 2EC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.