2EDI: NEDD8-conjugating enzyme UBE2F

Solution structure of the UQ_con domain from human NEDD8-conjugating enzyme NCE2. Determined by solution NMR. Released 14 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,371
Mol. weight: 19.51 kDa
Released: 14 Aug 2007

Explore 2EDI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EDI contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	14-29	16
β-strand	34-37	4	1
β-strand	47-51	5	1
β-strand	63-68	6	1
α-helix	77-78	2
β-strand	79-82	4	1
α-helix	118-127	10
α-helix	141-149	9
α-helix	151-165	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NEDD8-conjugating enzyme UBE2F	A	protein	173	Homo sapiens	Q969M7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EDI_1 NEDD8-conjugating enzyme UBE2F (chains A)
GSSGSSGSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQG
GKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKD
VVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYARSGPSSG

Primary citation

Solution structure of the UQ_con domain from human NEDD8-conjugating enzyme NCE2. Endo, H., Izumi, K., Yoshida, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q969M7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GBA 2.4 Å, DCNL complex with N-terminally acetylated NEDD8 E2 peptide
3FN1 2.5 Å, E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.

Browse structure collections

About this viewer

MolViewer shows 2EDI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.